BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV120063.Seq (784 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AB083011-1|BAC54132.1| 135|Apis mellifera fatty acid binding pr... 25 0.79 AJ780964-1|CAG62942.2| 332|Apis mellifera putative corticotropi... 25 1.1 AF159569-1|AAF70859.1| 1124|Apis mellifera period clock protein ... 24 1.8 AY350618-1|AAQ57660.1| 425|Apis mellifera complementary sex det... 22 5.6 AY569705-1|AAS86658.1| 419|Apis mellifera complementary sex det... 21 9.8 AB204559-1|BAD89804.1| 832|Apis mellifera soluble guanylyl cycl... 21 9.8 >AB083011-1|BAC54132.1| 135|Apis mellifera fatty acid binding protein protein. Length = 135 Score = 25.0 bits (52), Expect = 0.79 Identities = 16/63 (25%), Positives = 25/63 (39%) Frame = +3 Query: 594 TLPIMLSRKESNEIETASNNFFVSPYVSQILKYSESVKFPDNPPNKYVVDNLNLIVTKKV 773 TLP + RK N F V+ LK + +F DN ++ N + + +V Sbjct: 72 TLPSLPDRKFQTVTSIEGNTFKTETQVNDSLKVTRLYEFSDNELLVHISTNKSDVKATRV 131 Query: 774 RSR 782 R Sbjct: 132 YKR 134 >AJ780964-1|CAG62942.2| 332|Apis mellifera putative corticotropin releasing hormone-binding protein protein. Length = 332 Score = 24.6 bits (51), Expect = 1.1 Identities = 11/23 (47%), Positives = 13/23 (56%) Frame = -2 Query: 363 FYAGFFNQIVRNHKSNFIKRYHK 295 F GFFN I K N +RYH+ Sbjct: 15 FIIGFFNAISGAIKGNDYQRYHQ 37 >AF159569-1|AAF70859.1| 1124|Apis mellifera period clock protein protein. Length = 1124 Score = 23.8 bits (49), Expect = 1.8 Identities = 13/37 (35%), Positives = 23/37 (62%) Frame = +3 Query: 636 ETASNNFFVSPYVSQILKYSESVKFPDNPPNKYVVDN 746 E++S++F Y S + K SES PD P +Y++++ Sbjct: 952 ESSSSSF----YSSFLYKSSESSCNPDQKPTEYLLED 984 >AY350618-1|AAQ57660.1| 425|Apis mellifera complementary sex determiner protein. Length = 425 Score = 22.2 bits (45), Expect = 5.6 Identities = 15/49 (30%), Positives = 23/49 (46%), Gaps = 2/49 (4%) Frame = +3 Query: 618 KESNEIETASNNFFVSPYVSQILKYSESVKFPDNPPNKY--VVDNLNLI 758 KE I + SNN+ S Y + Y+ + +N N Y + N+N I Sbjct: 310 KEPKIISSLSNNYKYSNYNNYNNNYNNYNNYNNNYNNNYKKLYYNINYI 358 >AY569705-1|AAS86658.1| 419|Apis mellifera complementary sex determiner protein. Length = 419 Score = 21.4 bits (43), Expect = 9.8 Identities = 5/27 (18%), Positives = 17/27 (62%) Frame = +2 Query: 128 NDYNSNRFSDHMSETGYYMFVVKKSEV 208 N+YN+N ++++ + Y +++ ++ Sbjct: 331 NNYNNNNYNNYNKKLYYKNYIINIEQI 357 >AB204559-1|BAD89804.1| 832|Apis mellifera soluble guanylyl cyclase beta-3 protein. Length = 832 Score = 21.4 bits (43), Expect = 9.8 Identities = 12/37 (32%), Positives = 16/37 (43%) Frame = -2 Query: 303 YHKHTIIYHVIVVCIFDTTLLTYLANIISNGFTSLFL 193 YHK I V +FDT +T+ + FT L Sbjct: 156 YHKELQIELVREEILFDTVHVTFKLTFDNRAFTQASL 192 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 223,699 Number of Sequences: 438 Number of extensions: 4827 Number of successful extensions: 15 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 15 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 15 length of database: 146,343 effective HSP length: 57 effective length of database: 121,377 effective search space used: 24639531 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -