BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV120062.Seq (722 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 02_05_1146 - 34440647-34441674,34442138-34443896 29 3.7 >02_05_1146 - 34440647-34441674,34442138-34443896 Length = 928 Score = 29.1 bits (62), Expect = 3.7 Identities = 12/35 (34%), Positives = 23/35 (65%) Frame = -2 Query: 466 LAFLYGNGMSLP*TKNIALYTLKTLKLFRNKPNFN 362 LA+ Y +SLP +I+LYT + +++ + +P +N Sbjct: 701 LAYRYDPQVSLPELSSISLYTPRLVEVVKERPRWN 735 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,356,091 Number of Sequences: 37544 Number of extensions: 208083 Number of successful extensions: 282 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 280 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 282 length of database: 14,793,348 effective HSP length: 80 effective length of database: 11,789,828 effective search space used: 1886372480 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -