BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV120062.Seq (722 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value CR954257-12|CAJ14163.1| 1645|Anopheles gambiae putative cytoskel... 25 2.4 EF595743-1|ABQ88369.1| 1893|Anopheles gambiae voltage-gated calc... 23 9.6 >CR954257-12|CAJ14163.1| 1645|Anopheles gambiae putative cytoskeletal structural protein protein. Length = 1645 Score = 25.0 bits (52), Expect = 2.4 Identities = 9/25 (36%), Positives = 14/25 (56%) Frame = -2 Query: 379 NKPNFNISRLLNYAIVYFYKFTKSE 305 N P N+ ++L+Y YF K K + Sbjct: 1161 NMPELNMKQILDYKAAYFGKLPKHQ 1185 >EF595743-1|ABQ88369.1| 1893|Anopheles gambiae voltage-gated calcium channel alpha1 subunit protein. Length = 1893 Score = 23.0 bits (47), Expect = 9.6 Identities = 15/53 (28%), Positives = 28/53 (52%), Gaps = 8/53 (15%) Frame = -3 Query: 339 LLYIFINSQNPNPNDSHSYS------LIVFLRNIVFQVFNVFP--LSLTFQND 205 LLY+ I+S + H++ I+++ I F + N+F + +TFQN+ Sbjct: 1076 LLYVSIDSHEEDSGPIHNFRPIVAAYYIIYIIIIAFFMVNIFVGFVIVTFQNE 1128 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 592,156 Number of Sequences: 2352 Number of extensions: 10208 Number of successful extensions: 11 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 11 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 11 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 73597131 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -