BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV120062.Seq (722 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value X82835-1|CAA58042.1| 1977|Homo sapiens sodium channel alpha subu... 31 3.2 DQ857292-1|ABI51981.1| 1977|Homo sapiens voltage-gated sodium ch... 31 3.2 >X82835-1|CAA58042.1| 1977|Homo sapiens sodium channel alpha subunit protein. Length = 1977 Score = 31.5 bits (68), Expect = 3.2 Identities = 15/52 (28%), Positives = 29/52 (55%) Frame = -3 Query: 387 YLEISQILIFRDC*IMLLYIFINSQNPNPNDSHSYSLIVFLRNIVFQVFNVF 232 YL + Q+ F+ I ++Y ++S N + + YSL +++ +VF +F F Sbjct: 1385 YLSLLQVATFKGWTI-IMYAAVDSVNVDKQPKYEYSLYMYIYFVVFIIFGSF 1435 >DQ857292-1|ABI51981.1| 1977|Homo sapiens voltage-gated sodium channel Nav1.7 protein. Length = 1977 Score = 31.5 bits (68), Expect = 3.2 Identities = 15/52 (28%), Positives = 29/52 (55%) Frame = -3 Query: 387 YLEISQILIFRDC*IMLLYIFINSQNPNPNDSHSYSLIVFLRNIVFQVFNVF 232 YL + Q+ F+ I ++Y ++S N + + YSL +++ +VF +F F Sbjct: 1385 YLSLLQVATFKGWTI-IMYAAVDSVNVDKQPKYEYSLYMYIYFVVFIIFGSF 1435 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 77,106,454 Number of Sequences: 237096 Number of extensions: 1279885 Number of successful extensions: 1399 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1360 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1399 length of database: 76,859,062 effective HSP length: 88 effective length of database: 55,994,614 effective search space used: 8511181328 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -