BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV120062.Seq (722 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AB083010-1|BAC54131.1| 132|Apis mellifera fatty acid binding pr... 24 1.7 AJ547798-1|CAD67999.1| 587|Apis mellifera octopamine receptor p... 21 8.9 >AB083010-1|BAC54131.1| 132|Apis mellifera fatty acid binding protein protein. Length = 132 Score = 23.8 bits (49), Expect = 1.7 Identities = 10/17 (58%), Positives = 12/17 (70%) Frame = -2 Query: 427 TKNIALYTLKTLKLFRN 377 T+N LYTLKT F+N Sbjct: 44 TENNGLYTLKTTSPFKN 60 >AJ547798-1|CAD67999.1| 587|Apis mellifera octopamine receptor protein. Length = 587 Score = 21.4 bits (43), Expect = 8.9 Identities = 10/35 (28%), Positives = 16/35 (45%) Frame = -3 Query: 537 KAEIKIILID*ETYRTKSSANKSLWPSCTETECHY 433 K +I + ET TK + + C++T HY Sbjct: 338 KIKISVSYPSTETLNTKCNTLERTPSKCSQTSVHY 372 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 159,606 Number of Sequences: 438 Number of extensions: 2987 Number of successful extensions: 2 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 22413960 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -