BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV120060.Seq (735 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 03_01_0148 + 1174097-1174289,1174539-1174672,1174760-1175098 105 5e-23 01_07_0123 + 41206782-41206844,41207701-41207782,41208587-412087... 97 2e-20 08_02_0516 + 18080706-18080760,18081796-18081885,18082479-180825... 31 1.3 02_05_1298 - 35542250-35542831,35543218-35543410,35543511-355438... 28 8.8 >03_01_0148 + 1174097-1174289,1174539-1174672,1174760-1175098 Length = 221 Score = 105 bits (251), Expect = 5e-23 Identities = 45/72 (62%), Positives = 62/72 (86%) Frame = +2 Query: 260 EKKARKIMSKLGLKPVQGVERVTIRKSKNILFVINSPDVYKNPHSDTYIVFGEAKIEDLS 439 EKK+RK M KLG+KPV GV R+TI+++KNILFV++ PDV+K+P S+TY++FGEAKIEDLS Sbjct: 81 EKKSRKAMMKLGMKPVTGVSRITIKRAKNILFVVSKPDVFKSPTSETYVIFGEAKIEDLS 140 Query: 440 TQATMAAAERFK 475 +Q AA++F+ Sbjct: 141 SQLQAQAAQQFR 152 Score = 47.6 bits (108), Expect = 1e-05 Identities = 23/32 (71%), Positives = 29/32 (90%) Frame = +1 Query: 598 IVMSQANVSRAKAVRALKNNQSDIVNAIMELT 693 +VM+QA+VSRAKAV+ALK + DIV+AIMELT Sbjct: 189 LVMTQASVSRAKAVKALKAHDGDIVSAIMELT 220 >01_07_0123 + 41206782-41206844,41207701-41207782,41208587-41208717, 41208758-41209147 Length = 221 Score = 96.7 bits (230), Expect = 2e-20 Identities = 52/94 (55%), Positives = 65/94 (69%), Gaps = 19/94 (20%) Frame = +2 Query: 260 EKKARKIMSKLGLKPVQGVERVTIRKSKN-------------------ILFVINSPDVYK 382 EKK+RK M KLG+K + GV RVTI+KSKN ILFVI+ PDV+K Sbjct: 64 EKKSRKAMQKLGMKTITGVSRVTIKKSKNAHRIVIYHCILLNFSLHYQILFVISKPDVFK 123 Query: 383 NPHSDTYIVFGEAKIEDLSTQATMAAAERFKAPE 484 +P+SDTY++FGEAKIEDLS+Q AAE+FKAP+ Sbjct: 124 SPNSDTYVIFGEAKIEDLSSQLQTQAAEQFKAPD 157 Score = 43.2 bits (97), Expect = 2e-04 Identities = 21/32 (65%), Positives = 26/32 (81%) Frame = +1 Query: 598 IVMSQANVSRAKAVRALKNNQSDIVNAIMELT 693 +VM+QA VSR++AV+ALK DIV AIMELT Sbjct: 189 LVMTQATVSRSRAVKALKAANGDIVTAIMELT 220 >08_02_0516 + 18080706-18080760,18081796-18081885,18082479-18082573, 18083658-18083726,18083812-18084393 Length = 296 Score = 30.7 bits (66), Expect = 1.3 Identities = 14/36 (38%), Positives = 20/36 (55%) Frame = +3 Query: 393 QTPTLFLVKPRLKICPHRPPWLQQRDSRHQRPQPLA 500 Q P ++ +L P +PP LQ + HQ+PQP A Sbjct: 244 QQPPQLQLQSQLHPQPQQPPQLQPQPQLHQQPQPQA 279 >02_05_1298 - 35542250-35542831,35543218-35543410,35543511-35543827, 35544144-35544186,35545845-35545900,35546028-35546102, 35546249-35546345,35546422-35546546,35547063-35547167, 35547295-35547432,35547758-35547831,35547995-35548065, 35548168-35548363,35548482-35548572,35549264-35549342, 35549431-35549491,35549745-35549814,35549913-35549987, 35550119-35550194,35550403-35550489,35550744-35550880, 35551000-35551063,35551351-35551415 Length = 958 Score = 27.9 bits (59), Expect = 8.8 Identities = 13/29 (44%), Positives = 18/29 (62%) Frame = -1 Query: 150 SHCQMMQSLLCASRS*RRWPCQVQSVLAS 64 S C +QSL+ ++ +RWP V S LAS Sbjct: 422 SLCSSLQSLILSNNKIKRWPGTVFSSLAS 450 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,699,627 Number of Sequences: 37544 Number of extensions: 303093 Number of successful extensions: 809 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 787 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 809 length of database: 14,793,348 effective HSP length: 80 effective length of database: 11,789,828 effective search space used: 1933531792 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -