Bombyx BLAST Result against arabidopsis

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= NV120057.Seq
         (788 letters)

Database: arabidopsis 
           28,952 sequences; 12,070,560 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

At1g26510.1 68414.m03231 F-box family protein contains F-box dom...    28   8.1  

>At1g26510.1 68414.m03231 F-box family protein contains F-box domain
           Pfam:PF00646
          Length = 686

 Score = 27.9 bits (59), Expect = 8.1
 Identities = 16/67 (23%), Positives = 36/67 (53%), Gaps = 1/67 (1%)
 Frame = +3

Query: 474 YKNETCQMQQSSTVTEIVNSDEKIQKTYELAEFDLKNLS-SLESYETLKIKLALSKYMAM 650
           + N+   M+  S  T+ VN++  +QK+ E  +FD   L   +E +  L +K ++++++ +
Sbjct: 330 HSNQRLIMRTRSKKTKTVNNNNDLQKSEEKQKFDQLPLDLEIEMFRRLPLK-SVARFLTL 388

Query: 651 LSTLEMT 671
             +   T
Sbjct: 389 SKSCATT 395


  Database: arabidopsis
    Posted date:  Oct 4, 2007 10:56 AM
  Number of letters in database: 12,070,560
  Number of sequences in database:  28,952
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 14,546,673
Number of Sequences: 28952
Number of extensions: 259966
Number of successful extensions: 535
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 525
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 535
length of database: 12,070,560
effective HSP length: 80
effective length of database: 9,754,400
effective search space used: 1775300800
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)