BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV120053.Seq (771 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 09_02_0077 + 3964729-3964734,3965194-3965289,3965744-3973579,397... 66 3e-11 05_01_0431 + 3412178-3412336,3413012-3413109,3413185-3413312,341... 54 1e-07 03_05_0712 - 27057858-27057941,27058093-27058182,27058268-270583... 45 6e-05 05_01_0168 + 1162459-1162785,1163609-1163719,1163853-1163969,116... 42 5e-04 05_05_0136 - 22631260-22631325,22631735-22631821,22631898-226320... 40 0.002 09_04_0560 - 18519024-18519145,18519330-18519435,18519671-185199... 32 0.58 11_04_0236 + 15215386-15216197,15216854-15218888,15219131-152200... 30 2.4 04_04_1250 + 32077590-32078000,32078132-32078308,32078437-320785... 30 2.4 02_01_0014 - 87215-87280,87358-87495,87593-87721,87801-87869,879... 30 2.4 04_01_0308 + 4188726-4190351 29 5.4 >09_02_0077 + 3964729-3964734,3965194-3965289,3965744-3973579, 3973665-3973982,3974565-3974763,3974937-3975202, 3975288-3975574,3976714-3977818,3977900-3978046, 3978146-3978226,3978315-3978540,3978622-3978761, 3979539-3979645,3979739-3979841 Length = 3638 Score = 66.1 bits (154), Expect = 3e-11 Identities = 37/91 (40%), Positives = 50/91 (54%), Gaps = 9/91 (9%) Frame = +1 Query: 10 NCEYKNGYSETDQQIRWFWETFHELPLEDKKKFLLFLTGSDRVPIQGMRDI-------KI 168 N EY GYS I WFWE + ED +FL F+TG+ +VP++G + + + Sbjct: 3529 NAEYI-GYSPASPVILWFWEVVNGFSKEDMARFLQFVTGTSKVPLEGFKALQGISGPQRF 3587 Query: 169 RIQPV--ADDRFFPVAHTCFNLLDLPRYKTK 255 +I A +R P AHTCFN LDLP Y +K Sbjct: 3588 QIHKAYGAPER-LPSAHTCFNQLDLPEYSSK 3617 >05_01_0431 + 3412178-3412336,3413012-3413109,3413185-3413312, 3413770-3413881,3414309-3414489,3414714-3414896, 3415133-3415315,3416062-3416131,3416413-3416522, 3416604-3416908,3417079-3417175,3417622-3417765, 3418217-3418303,3418387-3418473,3418566-3418706, 3418805-3418930,3419166-3419264,3419690-3419757, 3420275-3420341,3420713-3420883,3420959-3421048, 3421831-3421911,3423397-3423470,3423784-3423855, 3423925-3424017,3424138-3424204 Length = 1030 Score = 54.0 bits (124), Expect = 1e-07 Identities = 32/93 (34%), Positives = 44/93 (47%), Gaps = 9/93 (9%) Frame = +1 Query: 4 QNNCEYKNGYSETDQQIRWFWETFHELPLEDKKKFLLFLTGSDRVPIQGMR--DIKIRIQ 177 ++N Y GY + I FWE ++KKFL F+TG R P+ G + + K IQ Sbjct: 918 RSNTNYSGGYHPDHELIDIFWEVLKSFSSHNQKKFLKFVTGCSRGPLLGFQYLEPKFCIQ 977 Query: 178 PVA-------DDRFFPVAHTCFNLLDLPRYKTK 255 D+ P + TC NLL LP Y+ K Sbjct: 978 RAGVPGMEEEDEDRLPTSATCMNLLKLPPYRNK 1010 >03_05_0712 - 27057858-27057941,27058093-27058182,27058268-27058384, 27059759-27059866,27060314-27060406,27060499-27060669, 27061505-27061757,27061860-27062138,27062939-27063273, 27063364-27064332,27064711-27065182,27065243-27065291, 27066564-27066804,27067606-27067695,27068172-27068294, 27068365-27068418 Length = 1175 Score = 45.2 bits (102), Expect = 6e-05 Identities = 28/96 (29%), Positives = 43/96 (44%), Gaps = 14/96 (14%) Frame = +1 Query: 4 QNNCEYKNGYSETDQQIRWFWETFHELPLEDKKKFLLFLTGSDRVPIQGMRDIK--IRIQ 177 +NN +Y GY+E+ + ++ FWE ++ L F+T R P+ G + ++ I Sbjct: 1058 RNNTKYTGGYTESSRSVKLFWEVIKGFKPTERCMLLKFVTSCSRAPLLGFKYLQPSFTIH 1117 Query: 178 PV------------ADDRFFPVAHTCFNLLDLPRYK 249 V D P A TC+N L LP YK Sbjct: 1118 KVPCDVTLWATIGGQDVDRLPSASTCYNTLKLPTYK 1153 >05_01_0168 + 1162459-1162785,1163609-1163719,1163853-1163969, 1164082-1164240,1164663-1164797,1165116-1165268, 1165358-1165479,1165599-1166541,1166677-1166728, 1166873-1167963,1168058-1168384,1168479-1168559, 1168649-1168717,1168809-1168937,1169038-1169121, 1169210-1169275 Length = 1321 Score = 41.9 bits (94), Expect = 5e-04 Identities = 23/90 (25%), Positives = 41/90 (45%), Gaps = 6/90 (6%) Frame = +1 Query: 4 QNNCEYKNGYSETDQQIRWFWETFHELPLEDKKKFLLFLTGSDRVPIQGMRDIKIRIQPV 183 +++ + GY + F E E ED++ FL F TG+ ++P+ G+ + ++ V Sbjct: 1211 EDHINFDYGYDANSASVISFLEILREFGREDQRAFLHFTTGAPQLPLGGLASLDPKLTVV 1270 Query: 184 AD------DRFFPVAHTCFNLLDLPRYKTK 255 D P +TC + LP Y +K Sbjct: 1271 RKQCDGKVDNELPSVNTCRHFFKLPPYSSK 1300 >05_05_0136 - 22631260-22631325,22631735-22631821,22631898-22632026, 22632122-22632190,22632271-22632351,22632598-22632702, 22632786-22633016,22633098-22634272,22634391-22634457, 22636705-22637778,22638119-22638274,22638827-22638985, 22639062-22639220,22639306-22639422,22639502-22639612, 22639690-22640358 Length = 1484 Score = 40.3 bits (90), Expect = 0.002 Identities = 26/91 (28%), Positives = 43/91 (47%), Gaps = 8/91 (8%) Frame = +1 Query: 7 NNCEYKNGYSETDQQIRWFWETFHELPLEDKKKFLLFLTGSDRVPIQGMRDIKIRIQPV- 183 ++ ++ +GY+ + + E E ++ FL F+TGS R+P G+ + ++ V Sbjct: 1374 DHIKFDHGYTSSSPPVINLLEVIQEFEGHQRRAFLQFITGSPRLPPGGLAALNPKLTVVR 1433 Query: 184 -------ADDRFFPVAHTCFNLLDLPRYKTK 255 ADD P TC N L LP Y +K Sbjct: 1434 KQHNSNEADDD-LPSVMTCANYLKLPPYSSK 1463 >09_04_0560 - 18519024-18519145,18519330-18519435,18519671-18519907, 18521371-18521810,18523215-18525012 Length = 900 Score = 31.9 bits (69), Expect = 0.58 Identities = 21/59 (35%), Positives = 31/59 (52%), Gaps = 4/59 (6%) Frame = +1 Query: 82 LPLEDKKKFLLFLTGSDRVPIQGMRDI--KIRIQPVAD--DRFFPVAHTCFNLLDLPRY 246 L +E +++ L F T +P G + K+ I V++ DR P +HTCF L LP Y Sbjct: 751 LSIEQQRQLLFFWTSVKYLPSDGFGGLASKLYIYKVSESADRL-PSSHTCFYRLCLPAY 808 >11_04_0236 + 15215386-15216197,15216854-15218888,15219131-15220017, 15222420-15226194 Length = 2502 Score = 29.9 bits (64), Expect = 2.4 Identities = 19/53 (35%), Positives = 25/53 (47%), Gaps = 4/53 (7%) Frame = +1 Query: 118 LTGSDRVPI----QGMRDIKIRIQPVADDRFFPVAHTCFNLLDLPRYKTKRGS 264 LTG PI +R +R + DD +A TC +L DL Y+ RGS Sbjct: 2229 LTGQQLAPIIRSCGNLRTFCVR-DSIGDDGLSAIAETCLDLQDLRVYRLLRGS 2280 >04_04_1250 + 32077590-32078000,32078132-32078308,32078437-32078561, 32078629-32078761,32078866-32079015,32079105-32079158, 32079437-32079532,32080021-32080095,32080723-32080824, 32080903-32081589,32081686-32081817,32081916-32082023, 32082170-32082319 Length = 799 Score = 29.9 bits (64), Expect = 2.4 Identities = 15/34 (44%), Positives = 19/34 (55%) Frame = +1 Query: 460 TSLVSLNKRVVSIDFVPS*ILCNLCFHGSITITI 561 T L L++R V D + +CN CFHGS I I Sbjct: 208 TILCDLHRRRVWFDDRTANAICNACFHGSSRIMI 241 >02_01_0014 - 87215-87280,87358-87495,87593-87721,87801-87869, 87962-88042,88133-88237,88338-88568,88665-90197, 90660-90752,91477-92887,93184-93305,93479-93718, 94521-94682,94770-94937,95025-95141,95266-95376, 95919-96506 Length = 1787 Score = 29.9 bits (64), Expect = 2.4 Identities = 29/102 (28%), Positives = 41/102 (40%), Gaps = 19/102 (18%) Frame = +1 Query: 7 NNCEYKNGYSETDQQIRWFWETFHELPLEDKKKFLLFLTGSDRVPIQGMRDIK-----IR 171 +N ++ +GY+ I E E E + F F+TG+ R+P G+ + +R Sbjct: 1660 DNIKFDHGYTAKSPAIVNLLEIMAEFTPEQQHAFCQFVTGAPRLPPGGLAALNPKLTIVR 1719 Query: 172 IQP--------------VADDRFFPVAHTCFNLLDLPRYKTK 255 P ADD P TC N L LP Y TK Sbjct: 1720 KHPSSAVNTSNIAGVTESADDD-LPSVMTCANYLKLPPYSTK 1760 >04_01_0308 + 4188726-4190351 Length = 541 Score = 28.7 bits (61), Expect = 5.4 Identities = 13/36 (36%), Positives = 21/36 (58%) Frame = -3 Query: 544 IHENKDYIKFNLGRNQLKPPVYSKRQGTFEVDPARL 437 IH+NKD++K + Q + + K+Q FE + RL Sbjct: 115 IHDNKDFMKTENNKLQSEALIVEKKQIMFEAEIKRL 150 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 18,401,840 Number of Sequences: 37544 Number of extensions: 358501 Number of successful extensions: 737 Number of sequences better than 10.0: 10 Number of HSP's better than 10.0 without gapping: 724 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 733 length of database: 14,793,348 effective HSP length: 80 effective length of database: 11,789,828 effective search space used: 2075009728 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -