BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV120052.Seq (762 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value DQ855502-1|ABH88189.1| 126|Tribolium castaneum chemosensory pro... 25 0.50 DQ855495-1|ABH88182.1| 126|Tribolium castaneum chemosensory pro... 25 0.50 AF217810-1|AAF71998.1| 431|Tribolium castaneum fork head orthol... 25 0.66 >DQ855502-1|ABH88189.1| 126|Tribolium castaneum chemosensory protein 16 protein. Length = 126 Score = 25.4 bits (53), Expect = 0.50 Identities = 13/35 (37%), Positives = 21/35 (60%), Gaps = 1/35 (2%) Frame = +1 Query: 16 LVEGKPLYVGRAQKKAERQKELKRKFEQ-LKSERL 117 L+E KP + + K + Q E K+K+++ LK E L Sbjct: 90 LIENKPNWWQELESKFDPQGEYKKKYDELLKKEGL 124 >DQ855495-1|ABH88182.1| 126|Tribolium castaneum chemosensory protein 9 protein. Length = 126 Score = 25.4 bits (53), Expect = 0.50 Identities = 13/35 (37%), Positives = 21/35 (60%), Gaps = 1/35 (2%) Frame = +1 Query: 16 LVEGKPLYVGRAQKKAERQKELKRKFEQ-LKSERL 117 L+E KP + + K + Q E K+K+++ LK E L Sbjct: 90 LIENKPNWWQELESKFDPQGEYKKKYDELLKKEGL 124 >AF217810-1|AAF71998.1| 431|Tribolium castaneum fork head orthologue protein. Length = 431 Score = 25.0 bits (52), Expect = 0.66 Identities = 14/67 (20%), Positives = 27/67 (40%), Gaps = 1/67 (1%) Frame = +3 Query: 471 LYHRSLQHHVTMDSSNDSNKTYNSKVECTAPCKPSTQAASAYANM-QPTYRPAPRAPAQS 647 L+H + HH+ + S ++ + + P S YA+M Q Y P+ Sbjct: 347 LHHNPMSHHLKQEPSGFTSSNHPFSINRLLPTAESKADIKMYADMHQYGYNTLSPLPSSV 406 Query: 648 TIRTSLG 668 +++G Sbjct: 407 HSHSTIG 413 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 169,332 Number of Sequences: 336 Number of extensions: 3473 Number of successful extensions: 9 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 9 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 9 length of database: 122,585 effective HSP length: 56 effective length of database: 103,769 effective search space used: 20442493 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -