BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV120051.Seq (776 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPMIT.04 |cox3||cytochrome c oxidase 3|Schizosaccharomyces pombe... 94 2e-20 SPCC1753.01c |ssb2|SPCC584.06c, rpa2|single-stranded DNA binding... 26 6.9 >SPMIT.04 |cox3||cytochrome c oxidase 3|Schizosaccharomyces pombe|chr mitochondrial|||Manual Length = 273 Score = 94.3 bits (224), Expect = 2e-20 Identities = 42/89 (47%), Positives = 56/89 (62%) Frame = +3 Query: 477 IRILFYYFTSIEYIEASFTIADRIYGSTFFIATGFHGIHVIIGTLFLLICYIRHLNNHFS 656 + LF + EY A FTI+D +YG++F+ ATG HGIH+I+GT+ LL+ H + Sbjct: 181 LSFLFLGGQAYEYWNAPFTISDSVYGASFYFATGLHGIHIIVGTILLLVATYNIYTYHLT 240 Query: 657 KNHHFGFEAAA*Y*HFVDVV*LFLYISIY 743 HH GFE Y HF DVV LFLY++IY Sbjct: 241 NTHHNGFECGIYYWHFCDVVWLFLYLTIY 269 Score = 63.3 bits (147), Expect = 4e-11 Identities = 31/70 (44%), Positives = 44/70 (62%), Gaps = 2/70 (2%) Frame = +1 Query: 289 LSPNIEIGRI*PPSRITP--FNPFQIPLLNTIILIRSGVTVT*AHHSLIENNFSQTKQRL 462 LSP E+G + PP I +P ++PLLNT+IL+ SG ++T AH+SLI N + L Sbjct: 116 LSPTFELGAVWPPVGIADKTIDPLEVPLLNTVILLTSGASLTYAHYSLIARNRENALKGL 175 Query: 463 FLTILLGFYF 492 ++TI L F F Sbjct: 176 YMTIALSFLF 185 Score = 26.6 bits (56), Expect = 4.0 Identities = 12/24 (50%), Positives = 14/24 (58%) Frame = +2 Query: 149 RDISREGTYQGKHTILVNKGLR*G 220 RD+S E G HT V KGL+ G Sbjct: 69 RDMSTEANIHGAHTKAVTKGLKIG 92 >SPCC1753.01c |ssb2|SPCC584.06c, rpa2|single-stranded DNA binding protein Ssb2|Schizosaccharomyces pombe|chr 3|||Manual Length = 279 Score = 25.8 bits (54), Expect = 6.9 Identities = 13/42 (30%), Positives = 22/42 (52%) Frame = +3 Query: 579 FHGIHVIIGTLFLLICYIRHLNNHFSKNHHFGFEAAA*Y*HF 704 + I + G +++ YIR + +H + HF EA A + HF Sbjct: 130 YGNIKIFSGKIYIASQYIRTIKDHNEVHFHF-LEAIAVHLHF 170 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,245,011 Number of Sequences: 5004 Number of extensions: 35244 Number of successful extensions: 80 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 78 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 80 length of database: 2,362,478 effective HSP length: 71 effective length of database: 2,007,194 effective search space used: 375345278 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -