BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV120051.Seq (776 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_49800| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.8 SB_16296| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.3 >SB_49800| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 139 Score = 30.3 bits (65), Expect = 1.8 Identities = 18/55 (32%), Positives = 28/55 (50%) Frame = +3 Query: 462 IFNYFIRILFYYFTSIEYIEASFTIADRIYGSTFFIATGFHGIHVIIGTLFLLIC 626 IF +L +Y+T YI + DRI ++ T GI+VI+G F++ C Sbjct: 58 IFWMTAAMLVFYYTDF-YIAVK--VDDRINRPWLYLGTALIGINVIVGLYFVVWC 109 >SB_16296| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1152 Score = 28.3 bits (60), Expect = 7.3 Identities = 16/47 (34%), Positives = 24/47 (51%), Gaps = 1/47 (2%) Frame = +3 Query: 438 LLTNKTKIIFNYFIRILFYYFTSIEYIEASFTIA-DRIYGSTFFIAT 575 LLT +I+NY+ I++ F S+ IA D + S FF+ T Sbjct: 285 LLTVSLGVIYNYWALIVYVAFPSVHEANLKTCIAVDYTFDSIFFLDT 331 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,119,600 Number of Sequences: 59808 Number of extensions: 212557 Number of successful extensions: 322 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 307 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 322 length of database: 16,821,457 effective HSP length: 81 effective length of database: 11,977,009 effective search space used: 2119930593 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -