BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV120050.Seq (807 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value X04385-1|CAA27972.1| 2813|Homo sapiens protein ( Human mRNA for ... 33 1.6 X04146-1|CAA27765.1| 1400|Homo sapiens protein ( Human mRNA frag... 33 1.6 M60675-1|AAA61295.1| 958|Homo sapiens von Willebrand factor pro... 33 1.6 M25865-1|AAB59458.1| 2813|Homo sapiens von Willebrand factor pro... 33 1.6 M10321-1|AAB59512.1| 2074|Homo sapiens F8VWF protein. 33 1.6 >X04385-1|CAA27972.1| 2813|Homo sapiens protein ( Human mRNA for pre-pro-von Willebrand factor. ). Length = 2813 Score = 32.7 bits (71), Expect = 1.6 Identities = 14/32 (43%), Positives = 17/32 (53%) Frame = +2 Query: 284 MQCVSGRHVVRECPANKIFDRNLMSCVEAHPC 379 +QCV G H CP KI D L +CV+ C Sbjct: 1167 VQCVEGCHA--HCPPGKILDELLQTCVDPEDC 1196 >X04146-1|CAA27765.1| 1400|Homo sapiens protein ( Human mRNA fragment (5'terminus) for von Willebrand factor (vWF). ). Length = 1400 Score = 32.7 bits (71), Expect = 1.6 Identities = 14/32 (43%), Positives = 17/32 (53%) Frame = +2 Query: 284 MQCVSGRHVVRECPANKIFDRNLMSCVEAHPC 379 +QCV G H CP KI D L +CV+ C Sbjct: 1167 VQCVEGCHA--HCPPGKILDELLQTCVDPEDC 1196 >M60675-1|AAA61295.1| 958|Homo sapiens von Willebrand factor protein. Length = 958 Score = 32.7 bits (71), Expect = 1.6 Identities = 14/32 (43%), Positives = 17/32 (53%) Frame = +2 Query: 284 MQCVSGRHVVRECPANKIFDRNLMSCVEAHPC 379 +QCV G H CP KI D L +CV+ C Sbjct: 178 VQCVEGCHA--HCPPGKILDELLQTCVDPEDC 207 >M25865-1|AAB59458.1| 2813|Homo sapiens von Willebrand factor protein. Length = 2813 Score = 32.7 bits (71), Expect = 1.6 Identities = 14/32 (43%), Positives = 17/32 (53%) Frame = +2 Query: 284 MQCVSGRHVVRECPANKIFDRNLMSCVEAHPC 379 +QCV G H CP KI D L +CV+ C Sbjct: 1167 VQCVEGCHA--HCPPGKILDELLQTCVDPEDC 1196 >M10321-1|AAB59512.1| 2074|Homo sapiens F8VWF protein. Length = 2074 Score = 32.7 bits (71), Expect = 1.6 Identities = 14/32 (43%), Positives = 17/32 (53%) Frame = +2 Query: 284 MQCVSGRHVVRECPANKIFDRNLMSCVEAHPC 379 +QCV G H CP KI D L +CV+ C Sbjct: 428 VQCVEGCHA--HCPPGKILDELLQTCVDPEDC 457 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 119,994,083 Number of Sequences: 237096 Number of extensions: 2678416 Number of successful extensions: 9545 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 9071 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 9544 length of database: 76,859,062 effective HSP length: 89 effective length of database: 55,757,518 effective search space used: 9980595722 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -