BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV120048.Seq (771 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPCC18.03 |||shuttle craft like transcriptional regulator|Schizo... 30 0.32 SPAC4F8.12c |spp42|cwf6|U5 snRNP complex subunit Spp42|Schizosac... 26 6.9 SPBC4F6.11c |||asparagine synthase |Schizosaccharomyces pombe|ch... 25 9.1 >SPCC18.03 |||shuttle craft like transcriptional regulator|Schizosaccharomyces pombe|chr 3|||Manual Length = 1077 Score = 30.3 bits (65), Expect = 0.32 Identities = 18/41 (43%), Positives = 25/41 (60%), Gaps = 4/41 (9%) Frame = +3 Query: 333 SACPR-CGKSRMYFCYVCFIPVPA---LEGKIPYCKLPIKV 443 S+C + CGK RMY +VC P A + +IP CK P++V Sbjct: 725 SSCKKECGKRRMYCEHVCQSPCHAGHPCDERIP-CKAPLEV 764 >SPAC4F8.12c |spp42|cwf6|U5 snRNP complex subunit Spp42|Schizosaccharomyces pombe|chr 1|||Manual Length = 2363 Score = 25.8 bits (54), Expect = 6.9 Identities = 8/14 (57%), Positives = 12/14 (85%) Frame = +3 Query: 138 IVMFKWCYKINNLT 179 ++++KWC INNLT Sbjct: 973 LLVYKWCQGINNLT 986 >SPBC4F6.11c |||asparagine synthase |Schizosaccharomyces pombe|chr 2|||Manual Length = 548 Score = 25.4 bits (53), Expect = 9.1 Identities = 14/40 (35%), Positives = 22/40 (55%), Gaps = 1/40 (2%) Frame = +1 Query: 454 NTKERLMVKALQPMLLFLPTGCHS-VHISRYSRLSY*WKG 570 +T ++KALQ +L +P C S + S YSR+ + G Sbjct: 223 DTLHTYLIKALQDRVLTIPKLCSSNLDCSHYSRVCVLYSG 262 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 3,033,722 Number of Sequences: 5004 Number of extensions: 62340 Number of successful extensions: 150 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 146 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 150 length of database: 2,362,478 effective HSP length: 71 effective length of database: 2,007,194 effective search space used: 371330890 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -