BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV120048.Seq (771 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z99277-2|CAB16487.1| 557|Caenorhabditis elegans Hypothetical pr... 61 7e-10 AC006632-6|AAK85469.2| 123|Caenorhabditis elegans Hypothetical ... 30 2.1 >Z99277-2|CAB16487.1| 557|Caenorhabditis elegans Hypothetical protein Y53C12A.3 protein. Length = 557 Score = 61.3 bits (142), Expect = 7e-10 Identities = 28/60 (46%), Positives = 36/60 (60%) Frame = +3 Query: 330 RSACPRCGKSRMYFCYVCFIPVPALEGKIPYCKLPIKVDIIKHKGEINGKSTAAHAAVLA 509 +S CP C +R YFCY C P+P + P KLP VDI+KH E N KS+A H ++A Sbjct: 344 KSTCPGCKSNRKYFCYDCRTPMPGVF--TPTVKLPCAVDIVKHPMEKNSKSSALHCKIVA 401 >AC006632-6|AAK85469.2| 123|Caenorhabditis elegans Hypothetical protein F28A10.3 protein. Length = 123 Score = 29.9 bits (64), Expect = 2.1 Identities = 12/31 (38%), Positives = 20/31 (64%) Frame = -3 Query: 574 NNLSISRIIWNIWICVHCDIPWARTAAWAAV 482 NN+SI ++ W+ W+CV + A +AA A + Sbjct: 71 NNISILKLGWSAWMCVASAVLMAGSAALAVL 101 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,600,191 Number of Sequences: 27780 Number of extensions: 347205 Number of successful extensions: 768 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 750 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 767 length of database: 12,740,198 effective HSP length: 80 effective length of database: 10,517,798 effective search space used: 1851132448 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -