BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV120048.Seq (771 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY937243-1|AAX33677.1| 1370|Apis mellifera Toll-like receptor pr... 28 0.11 AY739658-1|AAU85297.1| 664|Apis mellifera hyperpolarization-act... 23 2.4 AY280848-1|AAQ16312.1| 632|Apis mellifera hyperpolarization-act... 23 2.4 AY736135-1|AAU84701.1| 253|Apis mellifera take-out-like carrier... 23 4.2 AB269871-1|BAF03050.1| 1923|Apis mellifera cell adhesion molecul... 21 9.6 AB257298-1|BAE93381.1| 1919|Apis mellifera Dscam family member A... 21 9.6 >AY937243-1|AAX33677.1| 1370|Apis mellifera Toll-like receptor protein. Length = 1370 Score = 27.9 bits (59), Expect = 0.11 Identities = 10/27 (37%), Positives = 16/27 (59%) Frame = +3 Query: 312 LSSLSSRSACPRCGKSRMYFCYVCFIP 392 ++S + AC + R+Y CYVC+ P Sbjct: 1048 MASAAPMPACFDSDRERLYDCYVCYSP 1074 >AY739658-1|AAU85297.1| 664|Apis mellifera hyperpolarization-activated ion channelvariant L protein. Length = 664 Score = 23.4 bits (48), Expect = 2.4 Identities = 11/27 (40%), Positives = 16/27 (59%) Frame = +1 Query: 298 QTLNRLVLYLVEVLAHVAASQECTFVM 378 +T+N +V L E AH +AS+E M Sbjct: 595 KTINAVVNALAEQAAHASASEESVHSM 621 >AY280848-1|AAQ16312.1| 632|Apis mellifera hyperpolarization-activated ion channel protein. Length = 632 Score = 23.4 bits (48), Expect = 2.4 Identities = 11/27 (40%), Positives = 16/27 (59%) Frame = +1 Query: 298 QTLNRLVLYLVEVLAHVAASQECTFVM 378 +T+N +V L E AH +AS+E M Sbjct: 563 KTINAVVNALAEQAAHASASEESVHSM 589 >AY736135-1|AAU84701.1| 253|Apis mellifera take-out-like carrier protein JHBP-1 protein. Length = 253 Score = 22.6 bits (46), Expect = 4.2 Identities = 11/37 (29%), Positives = 19/37 (51%) Frame = +2 Query: 542 IPDYPTDGKVVLLFPGAEAKSVRDLFNQQQNQPSYSE 652 + DY +GKV+LL KS +++ + + Y E Sbjct: 128 VADYKIEGKVLLLPVRGAGKSNITMYDLKSHNDIYCE 164 >AB269871-1|BAF03050.1| 1923|Apis mellifera cell adhesion molecule AbsCAM-Ig7B protein. Length = 1923 Score = 21.4 bits (43), Expect = 9.6 Identities = 10/21 (47%), Positives = 12/21 (57%) Frame = +2 Query: 530 TYPDIPDYPTDGKVVLLFPGA 592 T D+P P D KVV+ P A Sbjct: 1209 TEEDVPGSPADIKVVVSSPQA 1229 >AB257298-1|BAE93381.1| 1919|Apis mellifera Dscam family member AbsCAM-Ig7A protein. Length = 1919 Score = 21.4 bits (43), Expect = 9.6 Identities = 10/21 (47%), Positives = 12/21 (57%) Frame = +2 Query: 530 TYPDIPDYPTDGKVVLLFPGA 592 T D+P P D KVV+ P A Sbjct: 1205 TEEDVPGSPADIKVVVSSPQA 1225 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 208,113 Number of Sequences: 438 Number of extensions: 4512 Number of successful extensions: 12 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 12 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 12 length of database: 146,343 effective HSP length: 57 effective length of database: 121,377 effective search space used: 24154023 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -