BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV120047.Seq (809 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY176049-1|AAO19580.1| 515|Anopheles gambiae cytochrome P450 CY... 27 0.68 AJ271193-1|CAB66001.1| 1623|Anopheles gambiae laminin gamma 1 pr... 25 2.1 AY344834-1|AAR05805.1| 334|Anopheles gambiae ICHIT protein. 25 3.7 AY344833-1|AAR05804.1| 334|Anopheles gambiae ICHIT protein. 25 3.7 AY344832-1|AAR05803.1| 333|Anopheles gambiae ICHIT protein. 25 3.7 AY344831-1|AAR05802.1| 333|Anopheles gambiae ICHIT protein. 25 3.7 AY344830-1|AAR05801.1| 334|Anopheles gambiae ICHIT protein. 25 3.7 AY344829-1|AAR05800.1| 334|Anopheles gambiae ICHIT protein. 25 3.7 AJ010903-1|CAA09389.1| 373|Anopheles gambiae ICHIT protein prot... 25 3.7 DQ999006-1|ABJ99082.1| 282|Anopheles gambiae voltage-dependent ... 24 4.8 AY137768-1|AAN16031.1| 282|Anopheles gambiae porin protein. 24 4.8 AY082909-1|AAL89811.1| 282|Anopheles gambiae porin protein. 24 4.8 DQ370045-1|ABD18606.1| 285|Anopheles gambiae putative TIL domai... 24 6.4 AY579077-1|AAT81601.1| 101|Anopheles gambiae neuropeptide F pro... 23 8.4 >AY176049-1|AAO19580.1| 515|Anopheles gambiae cytochrome P450 CYP12F3 protein. Length = 515 Score = 27.1 bits (57), Expect = 0.68 Identities = 13/36 (36%), Positives = 18/36 (50%) Frame = +1 Query: 241 LEIIKPTETCRSTQNAM*RLSTVHACVAEEVSQFTP 348 L I PT+ R T + M L + AC+ E + F P Sbjct: 348 LRTIMPTKDTRLTASMMSNLPYLRACIKEGMRMFPP 383 >AJ271193-1|CAB66001.1| 1623|Anopheles gambiae laminin gamma 1 precursor protein. Length = 1623 Score = 25.4 bits (53), Expect = 2.1 Identities = 12/27 (44%), Positives = 16/27 (59%), Gaps = 1/27 (3%) Frame = +3 Query: 357 YLHCG-HSCLCTDCDETVNVDNTCPKC 434 Y + G H C +CDE ++DNT P C Sbjct: 433 YFNFGPHGCQPCNCDERGSLDNT-PSC 458 >AY344834-1|AAR05805.1| 334|Anopheles gambiae ICHIT protein. Length = 334 Score = 24.6 bits (51), Expect = 3.7 Identities = 10/15 (66%), Positives = 12/15 (80%) Frame = +2 Query: 50 SNLPQPPRSTTCTTV 94 S+LP PP +TT TTV Sbjct: 241 SDLPPPPPTTTTTTV 255 >AY344833-1|AAR05804.1| 334|Anopheles gambiae ICHIT protein. Length = 334 Score = 24.6 bits (51), Expect = 3.7 Identities = 10/15 (66%), Positives = 12/15 (80%) Frame = +2 Query: 50 SNLPQPPRSTTCTTV 94 S+LP PP +TT TTV Sbjct: 241 SDLPPPPPTTTTTTV 255 >AY344832-1|AAR05803.1| 333|Anopheles gambiae ICHIT protein. Length = 333 Score = 24.6 bits (51), Expect = 3.7 Identities = 10/15 (66%), Positives = 12/15 (80%) Frame = +2 Query: 50 SNLPQPPRSTTCTTV 94 S+LP PP +TT TTV Sbjct: 240 SDLPPPPPTTTTTTV 254 >AY344831-1|AAR05802.1| 333|Anopheles gambiae ICHIT protein. Length = 333 Score = 24.6 bits (51), Expect = 3.7 Identities = 10/15 (66%), Positives = 12/15 (80%) Frame = +2 Query: 50 SNLPQPPRSTTCTTV 94 S+LP PP +TT TTV Sbjct: 240 SDLPPPPPTTTTTTV 254 >AY344830-1|AAR05801.1| 334|Anopheles gambiae ICHIT protein. Length = 334 Score = 24.6 bits (51), Expect = 3.7 Identities = 10/15 (66%), Positives = 12/15 (80%) Frame = +2 Query: 50 SNLPQPPRSTTCTTV 94 S+LP PP +TT TTV Sbjct: 241 SDLPPPPPTTTTTTV 255 >AY344829-1|AAR05800.1| 334|Anopheles gambiae ICHIT protein. Length = 334 Score = 24.6 bits (51), Expect = 3.7 Identities = 10/15 (66%), Positives = 12/15 (80%) Frame = +2 Query: 50 SNLPQPPRSTTCTTV 94 S+LP PP +TT TTV Sbjct: 241 SDLPPPPPTTTTTTV 255 >AJ010903-1|CAA09389.1| 373|Anopheles gambiae ICHIT protein protein. Length = 373 Score = 24.6 bits (51), Expect = 3.7 Identities = 10/15 (66%), Positives = 12/15 (80%) Frame = +2 Query: 50 SNLPQPPRSTTCTTV 94 S+LP PP +TT TTV Sbjct: 241 SDLPPPPPTTTTTTV 255 >DQ999006-1|ABJ99082.1| 282|Anopheles gambiae voltage-dependent anion channel protein. Length = 282 Score = 24.2 bits (50), Expect = 4.8 Identities = 11/30 (36%), Positives = 19/30 (63%) Frame = +3 Query: 681 NFLTKKIINVYNKTEMCIRATFDGRYVAHT 770 N LT ++ +V N+ ++ +FDG +V HT Sbjct: 78 NTLTSEV-SVENQLVKGLKVSFDGMFVPHT 106 >AY137768-1|AAN16031.1| 282|Anopheles gambiae porin protein. Length = 282 Score = 24.2 bits (50), Expect = 4.8 Identities = 11/30 (36%), Positives = 19/30 (63%) Frame = +3 Query: 681 NFLTKKIINVYNKTEMCIRATFDGRYVAHT 770 N LT ++ +V N+ ++ +FDG +V HT Sbjct: 78 NTLTSEV-SVENQLVKGLKVSFDGMFVPHT 106 >AY082909-1|AAL89811.1| 282|Anopheles gambiae porin protein. Length = 282 Score = 24.2 bits (50), Expect = 4.8 Identities = 11/30 (36%), Positives = 19/30 (63%) Frame = +3 Query: 681 NFLTKKIINVYNKTEMCIRATFDGRYVAHT 770 N LT ++ +V N+ ++ +FDG +V HT Sbjct: 78 NTLTSEV-SVENQLVKGLKVSFDGMFVPHT 106 >DQ370045-1|ABD18606.1| 285|Anopheles gambiae putative TIL domain protein protein. Length = 285 Score = 23.8 bits (49), Expect = 6.4 Identities = 6/18 (33%), Positives = 12/18 (66%) Frame = -2 Query: 226 CPQSQLHVCCSAAP*TPC 173 CP+++++ CC+ P C Sbjct: 26 CPKNEVYSCCAPCPQKAC 43 >AY579077-1|AAT81601.1| 101|Anopheles gambiae neuropeptide F protein. Length = 101 Score = 23.4 bits (48), Expect = 8.4 Identities = 12/26 (46%), Positives = 14/26 (53%) Frame = +2 Query: 350 RYLSALRTFVFVHRLRRNGKRGQYVS 427 RYL L T H R GKRG Y++ Sbjct: 45 RYLQELETKHAQHARPRFGKRGGYLN 70 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 829,832 Number of Sequences: 2352 Number of extensions: 16592 Number of successful extensions: 74 Number of sequences better than 10.0: 14 Number of HSP's better than 10.0 without gapping: 66 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 74 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 85655418 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -