BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV120046.Seq (772 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value CR954257-8|CAJ14159.1| 562|Anopheles gambiae putative esterase ... 26 1.1 AJ459961-1|CAD31060.1| 700|Anopheles gambiae prophenoloxidase 8... 25 3.4 AJ439060-10|CAD27761.1| 1197|Anopheles gambiae putative FGF-sign... 24 4.5 AJ459962-1|CAD31061.1| 685|Anopheles gambiae prophenoloxidase 9... 24 6.0 AJ459960-1|CAD31059.1| 696|Anopheles gambiae prophenoloxidase 7... 24 6.0 AJ010195-1|CAA09034.1| 687|Anopheles gambiae prophenoloxidase p... 24 6.0 AF004916-1|AAB94672.1| 686|Anopheles gambiae pro-phenol oxidase... 24 6.0 AF444781-1|AAL37902.1| 1459|Anopheles gambiae Toll6 protein. 23 7.9 AF004915-1|AAB94671.1| 688|Anopheles gambiae pro-phenol oxidase... 23 7.9 >CR954257-8|CAJ14159.1| 562|Anopheles gambiae putative esterase protein. Length = 562 Score = 26.2 bits (55), Expect = 1.1 Identities = 16/68 (23%), Positives = 27/68 (39%), Gaps = 6/68 (8%) Frame = +3 Query: 534 PEHVLFACVARRIA---FFRRDQRPNASRWCWRSII*QLQWI---FAKFDSTRSSARVLA 695 PE V+ + R+ FF D A W + + LQW+ A F ++ + Sbjct: 142 PEDVVVVTINYRLGILGFFSTDDVHAAGNWGMKDCVMALQWVRQNIAAFGGDPNNVTIFG 201 Query: 696 NRHGGIEI 719 GG+ + Sbjct: 202 ESAGGVAV 209 >AJ459961-1|CAD31060.1| 700|Anopheles gambiae prophenoloxidase 8 protein. Length = 700 Score = 24.6 bits (51), Expect = 3.4 Identities = 9/22 (40%), Positives = 12/22 (54%) Frame = +3 Query: 564 RRIAFFRRDQRPNASRWCWRSI 629 +R+AFFR D N W W + Sbjct: 208 QRMAFFREDIGVNLHHWHWHLV 229 >AJ439060-10|CAD27761.1| 1197|Anopheles gambiae putative FGF-signaling promoter protein. Length = 1197 Score = 24.2 bits (50), Expect = 4.5 Identities = 12/31 (38%), Positives = 17/31 (54%) Frame = +2 Query: 260 SIQNDDR*AFSWK*RKRYQANFNSKRNQLPR 352 SIQ ++ WK R Q +F K++QL R Sbjct: 875 SIQEVEQLVTLWKNRNDVQKSFREKQDQLAR 905 >AJ459962-1|CAD31061.1| 685|Anopheles gambiae prophenoloxidase 9 protein. Length = 685 Score = 23.8 bits (49), Expect = 6.0 Identities = 8/22 (36%), Positives = 12/22 (54%) Frame = +3 Query: 564 RRIAFFRRDQRPNASRWCWRSI 629 +R+A+FR D N W W + Sbjct: 194 QRLAYFREDIGVNLHHWHWHLV 215 >AJ459960-1|CAD31059.1| 696|Anopheles gambiae prophenoloxidase 7 protein. Length = 696 Score = 23.8 bits (49), Expect = 6.0 Identities = 8/22 (36%), Positives = 12/22 (54%) Frame = +3 Query: 564 RRIAFFRRDQRPNASRWCWRSI 629 +R+A+FR D N W W + Sbjct: 207 QRLAYFREDIGVNLHHWHWHLV 228 >AJ010195-1|CAA09034.1| 687|Anopheles gambiae prophenoloxidase protein. Length = 687 Score = 23.8 bits (49), Expect = 6.0 Identities = 8/22 (36%), Positives = 12/22 (54%) Frame = +3 Query: 564 RRIAFFRRDQRPNASRWCWRSI 629 +R+A+FR D N W W + Sbjct: 194 QRLAYFREDIGVNLHHWHWHLV 215 Score = 23.4 bits (48), Expect = 7.9 Identities = 10/24 (41%), Positives = 13/24 (54%) Frame = +1 Query: 616 VGDQLFNNYSGFLQNLIRRAVAPE 687 V Q + NY G + NLI + PE Sbjct: 356 VNSQYYGNYHGHMHNLISFSHDPE 379 >AF004916-1|AAB94672.1| 686|Anopheles gambiae pro-phenol oxidase subunit 2 protein. Length = 686 Score = 23.8 bits (49), Expect = 6.0 Identities = 8/22 (36%), Positives = 12/22 (54%) Frame = +3 Query: 564 RRIAFFRRDQRPNASRWCWRSI 629 +R+A+FR D N W W + Sbjct: 193 QRLAYFREDIGVNLHHWHWHLV 214 >AF444781-1|AAL37902.1| 1459|Anopheles gambiae Toll6 protein. Length = 1459 Score = 23.4 bits (48), Expect = 7.9 Identities = 10/26 (38%), Positives = 13/26 (50%) Frame = -3 Query: 116 TMDAKMQRLTLICRGAIPTGISAILL 39 T+DA RLT + IP I + L Sbjct: 633 TLDASFNRLTRVTPATIPNSIEFLFL 658 >AF004915-1|AAB94671.1| 688|Anopheles gambiae pro-phenol oxidase subunit 1 protein. Length = 688 Score = 23.4 bits (48), Expect = 7.9 Identities = 8/22 (36%), Positives = 12/22 (54%) Frame = +3 Query: 564 RRIAFFRRDQRPNASRWCWRSI 629 +R+A+FR D N W W + Sbjct: 193 QRMAYFREDIGVNMHHWHWHLV 214 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 830,421 Number of Sequences: 2352 Number of extensions: 16321 Number of successful extensions: 83 Number of sequences better than 10.0: 9 Number of HSP's better than 10.0 without gapping: 79 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 83 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 80249979 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -