BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV120045.Seq (818 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 08_01_0841 + 8223768-8223871,8227749-8228745,8228779-8228828,822... 29 3.4 06_03_1511 - 30669292-30669401,30669894-30669930,30670012-306701... 28 7.8 >08_01_0841 + 8223768-8223871,8227749-8228745,8228779-8228828, 8228896-8230396 Length = 883 Score = 29.5 bits (63), Expect = 3.4 Identities = 19/69 (27%), Positives = 33/69 (47%) Frame = +3 Query: 36 VSNAANMVYICIDTGSHAKGYAVESSDTDYYIYTKCNRETFEKFIDNKELLKNRHAKDES 215 VS + + V + + AKG ES D Y++ +E+FE+F + + +N E Sbjct: 293 VSRSGSQVIVTTEIVHVAKG-CTESDDHVYWVQLLSKQESFERFKNLILVTENSKMTHED 351 Query: 216 GNDVKYVDL 242 D + +DL Sbjct: 352 REDFEDLDL 360 >06_03_1511 - 30669292-30669401,30669894-30669930,30670012-30670107, 30670186-30670281,30670679-30670828,30670956-30671100, 30671178-30671251,30671325-30671445,30671697-30671821, 30671898-30672047,30672249-30672324,30672496-30672557, 30672597-30672839,30673354-30673683,30673776-30673932, 30674008-30674139,30674219-30674277,30674734-30674798, 30674878-30675094,30675413-30675499,30675655-30675750, 30675938-30676003,30676096-30676287,30676380-30676532, 30676812-30677052,30677322-30677515,30678212-30678348, 30678474-30678480,30678708-30678830,30679370-30679427, 30680018-30680090,30680493-30681765 Length = 1714 Score = 28.3 bits (60), Expect = 7.8 Identities = 22/93 (23%), Positives = 40/93 (43%) Frame = -2 Query: 418 NFVSHQIINNFHHRHRHQLSYKLVQLQVFNTIFVFKIFTFTEHAQFGRFSSQNANNPVYK 239 NF+ + ++ +RH + + F+ IF+F++H + S + +Y+ Sbjct: 604 NFIGSEEVDLLVYRHLMSCDIDSALIPLILAKFIKSIFSFSQHWKHLCECSPEKHRLLYR 663 Query: 238 STYLTSLPDSSFACRFFKSSLLSINFSKVSRLH 140 T L L D C K++L N + S LH Sbjct: 664 HT-LAELGD--LVCEVSKANLPRENVKQNSLLH 693 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 20,065,338 Number of Sequences: 37544 Number of extensions: 376493 Number of successful extensions: 925 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 903 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 925 length of database: 14,793,348 effective HSP length: 81 effective length of database: 11,752,284 effective search space used: 2244686244 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -