BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV120045.Seq (818 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF444783-1|AAL37904.1| 1356|Anopheles gambiae Trex protein. 25 3.7 AY645023-1|AAT92559.1| 99|Anopheles gambiae wingless protein. 24 6.5 AB090813-1|BAC57901.1| 724|Anopheles gambiae gag-like protein p... 23 8.6 >AF444783-1|AAL37904.1| 1356|Anopheles gambiae Trex protein. Length = 1356 Score = 24.6 bits (51), Expect = 3.7 Identities = 13/34 (38%), Positives = 19/34 (55%) Frame = +1 Query: 697 QRGEYQQEWTEYFQQWKQRLQDDCTTCQNRQSAP 798 Q+ + QQ+ + QQ +Q+ Q T Q R SAP Sbjct: 1307 QQQQQQQQQQQQQQQQQQQHQPPSTQAQLRPSAP 1340 >AY645023-1|AAT92559.1| 99|Anopheles gambiae wingless protein. Length = 99 Score = 23.8 bits (49), Expect = 6.5 Identities = 6/20 (30%), Positives = 11/20 (55%) Frame = +3 Query: 282 NWACSVNVKILKTNMVLKTC 341 +W C V K+ + ++ TC Sbjct: 79 HWCCEVKCKLCRAKKIIHTC 98 >AB090813-1|BAC57901.1| 724|Anopheles gambiae gag-like protein protein. Length = 724 Score = 23.4 bits (48), Expect = 8.6 Identities = 13/34 (38%), Positives = 18/34 (52%) Frame = +1 Query: 697 QRGEYQQEWTEYFQQWKQRLQDDCTTCQNRQSAP 798 QR + QQ+ ++ QQ +Q Q Q RQS P Sbjct: 351 QRQQQQQQQQQHQQQQQQWQQQQQQQQQPRQSLP 384 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 845,269 Number of Sequences: 2352 Number of extensions: 18331 Number of successful extensions: 231 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 229 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 230 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 86902827 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -