BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV120043.Seq (810 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_42686| Best HMM Match : Pkinase (HMM E-Value=0) 50 2e-06 SB_15979| Best HMM Match : Pkinase (HMM E-Value=0) 46 5e-05 SB_51111| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 8e-05 SB_33125| Best HMM Match : Pkinase (HMM E-Value=0) 43 3e-04 SB_47181| Best HMM Match : Pkinase (HMM E-Value=7.7e-31) 42 4e-04 SB_54290| Best HMM Match : Pkinase (HMM E-Value=1.3e-26) 42 8e-04 SB_42711| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_26127| Best HMM Match : Pkinase (HMM E-Value=5.3e-10) 41 0.001 SB_3739| Best HMM Match : Pkinase (HMM E-Value=0) 40 0.002 SB_29733| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.002 SB_24175| Best HMM Match : Pkinase (HMM E-Value=6.2e-07) 40 0.002 SB_8759| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.002 SB_31780| Best HMM Match : Pkinase (HMM E-Value=0) 40 0.003 SB_1165| Best HMM Match : Pkinase (HMM E-Value=5.6e-23) 40 0.003 SB_39043| Best HMM Match : Pkinase (HMM E-Value=2.7e-09) 39 0.004 SB_53776| Best HMM Match : Pkinase_Tyr (HMM E-Value=4.5e-12) 38 0.007 SB_33829| Best HMM Match : Pkinase (HMM E-Value=0) 38 0.010 SB_17500| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.013 SB_36983| Best HMM Match : Pkinase (HMM E-Value=6.4e-22) 38 0.013 SB_11825| Best HMM Match : Pkinase (HMM E-Value=1.2e-17) 37 0.022 SB_18299| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.022 SB_12255| Best HMM Match : Pkinase (HMM E-Value=0) 37 0.022 SB_46550| Best HMM Match : Asn_synthase (HMM E-Value=0) 36 0.029 SB_59029| Best HMM Match : Pkinase (HMM E-Value=0) 36 0.039 SB_31698| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.051 SB_28982| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.051 SB_18697| Best HMM Match : Pkinase (HMM E-Value=5.9e-07) 36 0.051 SB_37647| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.051 SB_33732| Best HMM Match : Pkinase (HMM E-Value=9e-10) 35 0.068 SB_57581| Best HMM Match : Pkinase (HMM E-Value=4.7e-24) 35 0.068 SB_32519| Best HMM Match : Pkinase (HMM E-Value=7.3e-39) 35 0.090 SB_22253| Best HMM Match : Pkinase (HMM E-Value=0) 35 0.090 SB_31870| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.16 SB_11460| Best HMM Match : Pkinase (HMM E-Value=0) 34 0.16 SB_37321| Best HMM Match : Pkinase (HMM E-Value=2.4e-27) 33 0.27 SB_25723| Best HMM Match : Vicilin_N (HMM E-Value=0.0045) 33 0.36 SB_17930| Best HMM Match : Pkinase (HMM E-Value=0) 33 0.36 SB_9887| Best HMM Match : Pkinase (HMM E-Value=4.1e-37) 33 0.36 SB_26383| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.48 SB_18269| Best HMM Match : CUB (HMM E-Value=7.4e-37) 32 0.63 SB_26967| Best HMM Match : Pkinase (HMM E-Value=0) 32 0.63 SB_25818| Best HMM Match : Pkinase (HMM E-Value=1.7e-20) 32 0.63 SB_21523| Best HMM Match : Pkinase (HMM E-Value=9.5e-14) 31 1.1 SB_34086| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.1 SB_28695| Best HMM Match : Ras (HMM E-Value=0) 31 1.1 SB_41851| Best HMM Match : Pkinase (HMM E-Value=0) 31 1.5 SB_48446| Best HMM Match : Pkinase (HMM E-Value=1.2e-05) 30 1.9 SB_47948| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.9 SB_8812| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.6 SB_32748| Best HMM Match : Pkinase (HMM E-Value=7.8e-26) 30 2.6 SB_46497| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.4 SB_38378| Best HMM Match : Pkinase_Tyr (HMM E-Value=0) 29 3.4 SB_25790| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.4 SB_19466| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.4 SB_48455| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.5 SB_35776| Best HMM Match : Pkinase (HMM E-Value=0) 29 4.5 SB_11202| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.5 SB_54907| Best HMM Match : Pkinase (HMM E-Value=1.4e-10) 29 5.9 SB_46109| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.9 SB_36661| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.9 SB_31696| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.9 SB_10682| Best HMM Match : Pkinase (HMM E-Value=2.5e-07) 29 5.9 SB_4038| Best HMM Match : v110 (HMM E-Value=5.5) 29 5.9 SB_58974| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.8 SB_25040| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.8 SB_10408| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.8 SB_5779| Best HMM Match : Pkinase (HMM E-Value=1.8e-19) 28 7.8 >SB_42686| Best HMM Match : Pkinase (HMM E-Value=0) Length = 759 Score = 50.0 bits (114), Expect = 2e-06 Identities = 22/80 (27%), Positives = 42/80 (52%) Frame = -3 Query: 241 DEIKVHQLMNDHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIR 62 DEI + + HPN ++++ ++ +VM+ I DLF+ + + + + + R Sbjct: 492 DEIAIMRRCR-HPNIVRLFEDYDSATEIYLVMELIKGGDLFDAISSSVKFTEHVAKSYFR 550 Query: 61 QLCEALNDLHKHNFIHNDIK 2 +C+AL LHK +H D+K Sbjct: 551 DMCKALAYLHKRKIVHRDLK 570 >SB_15979| Best HMM Match : Pkinase (HMM E-Value=0) Length = 367 Score = 45.6 bits (103), Expect = 5e-05 Identities = 23/82 (28%), Positives = 45/82 (54%), Gaps = 1/82 (1%) Frame = -3 Query: 244 VDEIKVHQLMNDHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETL-QIKGELSHQLVSNI 68 ++E KV ++ HPN I Y + +I M+Y D L + L +++ ++ + + N+ Sbjct: 73 MNEAKVLSKLSLHPNIISYYDSFEVEGTLMIEMEYADGGTLAQYLTKLEKDMEEKDILNM 132 Query: 67 IRQLCEALNDLHKHNFIHNDIK 2 +Q+ AL +H +N +H D+K Sbjct: 133 FQQMLSALKYIHNNNILHRDLK 154 >SB_51111| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 428 Score = 44.8 bits (101), Expect = 8e-05 Identities = 20/69 (28%), Positives = 38/69 (55%) Frame = -3 Query: 208 HPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQLCEALNDLHK 29 HPN I++Y ++ IVM+Y +LF + +G+L ++ + Q+ A+ +H Sbjct: 117 HPNIIRLYEVIETLSKLHIVMEYACGGELFAKISNEGKLPERIAKKLYGQVLSAVEHMHD 176 Query: 28 HNFIHNDIK 2 ++ IH D+K Sbjct: 177 NDIIHRDLK 185 >SB_33125| Best HMM Match : Pkinase (HMM E-Value=0) Length = 937 Score = 42.7 bits (96), Expect = 3e-04 Identities = 21/79 (26%), Positives = 40/79 (50%) Frame = -3 Query: 238 EIKVHQLMNDHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQ 59 E+++ + + DHPN +K+Y +VM+Y ++F+ L G + + RQ Sbjct: 130 EVRIMKFL-DHPNIVKLYEVIETDKTLYLVMEYASGGEVFDYLVAHGRMKEKEARAKFRQ 188 Query: 58 LCEALNDLHKHNFIHNDIK 2 + A+ H+ + IH D+K Sbjct: 189 IVSAVQYCHQKHVIHRDLK 207 >SB_47181| Best HMM Match : Pkinase (HMM E-Value=7.7e-31) Length = 801 Score = 42.3 bits (95), Expect = 4e-04 Identities = 30/102 (29%), Positives = 50/102 (49%), Gaps = 7/102 (6%) Frame = -3 Query: 286 QIVFAENNFGANFNVDEIKVHQLMNDHPNFIKIYF----NHGFINNQVIVMDYIDCP--D 125 ++V E N+ + NV E++V++ M HPN + Y N + N I M+ D D Sbjct: 567 ELVLKETNY--SLNVQELEVYKRMGQHPNIVDHYCITLGNLKGLLNMNIFMEQCDMSLRD 624 Query: 124 LFETLQIKG-ELSHQLVSNIIRQLCEALNDLHKHNFIHNDIK 2 + ++ +G +LS Q+C A++ +H IH DIK Sbjct: 625 YLDYMKAEGSQLSVNEAMFYWTQVCMAVDHIHTSGIIHKDIK 666 >SB_54290| Best HMM Match : Pkinase (HMM E-Value=1.3e-26) Length = 239 Score = 41.5 bits (93), Expect = 8e-04 Identities = 26/79 (32%), Positives = 41/79 (51%), Gaps = 1/79 (1%) Frame = -3 Query: 235 IKVHQLMNDHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIK-GELSHQLVSNIIRQ 59 I + +++ D PN + + G +V +Y+D DL L+ L+ + + IRQ Sbjct: 38 INLKEIVTDKPNALDFRKDKGAF---YLVFEYMD-HDLMGLLESGLVHLTEDHIKSFIRQ 93 Query: 58 LCEALNDLHKHNFIHNDIK 2 L + LN HK NF+H DIK Sbjct: 94 LLDGLNYCHKKNFLHRDIK 112 >SB_42711| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 920 Score = 41.1 bits (92), Expect = 0.001 Identities = 21/79 (26%), Positives = 41/79 (51%) Frame = -3 Query: 238 EIKVHQLMNDHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQ 59 E+++ +L+ HP+ +K+Y N +V DY + ++F+ L G L + Q Sbjct: 204 EVQIMKLLQ-HPHIVKLYQVMETKNMLYLVTDYANNGEMFDYLAHHGRLPEKEARKKFVQ 262 Query: 58 LCEALNDLHKHNFIHNDIK 2 + A++ HK + +H D+K Sbjct: 263 ILSAVDYCHKRHVVHRDLK 281 >SB_26127| Best HMM Match : Pkinase (HMM E-Value=5.3e-10) Length = 460 Score = 41.1 bits (92), Expect = 0.001 Identities = 21/83 (25%), Positives = 41/83 (49%), Gaps = 4/83 (4%) Frame = -3 Query: 238 EIKVHQLMNDHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQL----VSN 71 E+ H ++ HP+ ++ Y N+ +I +Y D L + +Q +L +L + Sbjct: 183 EVYAHAVLGTHPHVVRYYSAWAEDNHMLIQNEYCDGGSLADRIQSNNKLGERLSEADLKM 242 Query: 70 IIRQLCEALNDLHKHNFIHNDIK 2 ++ QL + L +H + +H DIK Sbjct: 243 LLLQLAQGLKYIHSLHLVHMDIK 265 >SB_3739| Best HMM Match : Pkinase (HMM E-Value=0) Length = 490 Score = 40.3 bits (90), Expect = 0.002 Identities = 21/69 (30%), Positives = 38/69 (55%) Frame = -3 Query: 208 HPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQLCEALNDLHK 29 HPN +++Y +H + +VM++++ L + + LS + V+ + R + +AL LH Sbjct: 272 HPNIVEMYGSHLVGDELWVVMEFLEGGTLTDIVT-HTNLSEEQVACVCRAVLKALTFLHS 330 Query: 28 HNFIHNDIK 2 IH DIK Sbjct: 331 QGVIHRDIK 339 >SB_29733| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 360 Score = 39.9 bits (89), Expect = 0.002 Identities = 22/71 (30%), Positives = 35/71 (49%), Gaps = 2/71 (2%) Frame = -3 Query: 208 HPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGE--LSHQLVSNIIRQLCEALNDL 35 HPN +K+Y +V +YI +L ++ E LS I+RQ+ AL+ L Sbjct: 73 HPNIVKLYETLKQRGVYCLVTEYIPGGELLGLIRSHQESRLSETQARPIVRQIVSALHHL 132 Query: 34 HKHNFIHNDIK 2 H+ +H D+K Sbjct: 133 HEQGIVHRDLK 143 >SB_24175| Best HMM Match : Pkinase (HMM E-Value=6.2e-07) Length = 268 Score = 39.9 bits (89), Expect = 0.002 Identities = 25/77 (32%), Positives = 41/77 (53%), Gaps = 8/77 (10%) Frame = -3 Query: 208 HPNFIKIYFNHGFINNQ-----VIVMDY-IDCPDLFETLQIK--GELSHQLVSNIIRQLC 53 H N I++ ++ ++N+ VIVM+ C DLF LQI+ G + ++ I R + Sbjct: 110 HVNIIELLAHYTMLDNEQTSRHVIVMERPAHCLDLFSFLQIQPQGRVKEKVARKIFRDVM 169 Query: 52 EALNDLHKHNFIHNDIK 2 ++ L K +HNDIK Sbjct: 170 RGVDYLDKRGILHNDIK 186 >SB_8759| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1184 Score = 39.9 bits (89), Expect = 0.002 Identities = 21/70 (30%), Positives = 33/70 (47%) Frame = -3 Query: 211 DHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQLCEALNDLH 32 D+ +K+Y++ N VMDY+ DL L G I +L A++ +H Sbjct: 712 DNEWVVKLYYSFQDQENLYFVMDYVPGGDLMSLLIKFGIFPEDYAKFYIAELVLAIDSVH 771 Query: 31 KHNFIHNDIK 2 + F+H DIK Sbjct: 772 RMGFVHRDIK 781 >SB_31780| Best HMM Match : Pkinase (HMM E-Value=0) Length = 964 Score = 39.5 bits (88), Expect = 0.003 Identities = 23/83 (27%), Positives = 42/83 (50%), Gaps = 2/83 (2%) Frame = -3 Query: 244 VDEIKVHQLMNDHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGE--LSHQLVSN 71 ++E+KV + HPN I+ Y + +IVM+Y +++ LQ +G + + Sbjct: 49 LNEVKVLSMFQ-HPNIIRYYDSFVQEKALMIVMEYAQGGTIYDYLQQRGGKLMDEDEILR 107 Query: 70 IIRQLCEALNDLHKHNFIHNDIK 2 + Q+ AL +HK +H D+K Sbjct: 108 LFVQILLALRHVHKGQILHRDLK 130 >SB_1165| Best HMM Match : Pkinase (HMM E-Value=5.6e-23) Length = 560 Score = 39.5 bits (88), Expect = 0.003 Identities = 24/84 (28%), Positives = 38/84 (45%) Frame = -3 Query: 253 NFNVDEIKVHQLMNDHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVS 74 NF EI +L+ H N +K+Y +I M+Y+D + L G V Sbjct: 382 NFEECEIANWRLIQGHENVVKLYGAVQTEQKIIIFMEYMDGGSVEMFLSNNGSADEDSVK 441 Query: 73 NIIRQLCEALNDLHKHNFIHNDIK 2 +++ + EAL LH +H D+K Sbjct: 442 CVMQVILEALCWLHSKGVVHLDLK 465 >SB_39043| Best HMM Match : Pkinase (HMM E-Value=2.7e-09) Length = 239 Score = 39.1 bits (87), Expect = 0.004 Identities = 24/77 (31%), Positives = 41/77 (53%), Gaps = 8/77 (10%) Frame = -3 Query: 208 HPNFIKIYFNHGFINNQ-----VIVMDY-IDCPDLFETLQIK--GELSHQLVSNIIRQLC 53 H N I++ ++ ++N+ VIVM+ C DLF L+I+ G + ++ I R + Sbjct: 18 HVNIIELLAHYTMLDNEQTSRHVIVMERPAQCLDLFSFLEIQPQGRVKEKVARKIFRDVM 77 Query: 52 EALNDLHKHNFIHNDIK 2 ++ L K +HNDIK Sbjct: 78 RGVDYLDKRGILHNDIK 94 >SB_53776| Best HMM Match : Pkinase_Tyr (HMM E-Value=4.5e-12) Length = 640 Score = 38.3 bits (85), Expect = 0.007 Identities = 20/70 (28%), Positives = 35/70 (50%) Frame = -3 Query: 211 DHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQLCEALNDLH 32 +HPN I+ +VM+Y LFE L+ E++ +L+ Q+ + ++ LH Sbjct: 155 NHPNIIRFKGVCNQAPVYCVVMEYCPYGQLFEVLRDGREITPELLVGWTTQIADGMHYLH 214 Query: 31 KHNFIHNDIK 2 + IH D+K Sbjct: 215 GNKIIHRDLK 224 >SB_33829| Best HMM Match : Pkinase (HMM E-Value=0) Length = 290 Score = 37.9 bits (84), Expect = 0.010 Identities = 23/91 (25%), Positives = 42/91 (46%) Frame = -3 Query: 274 AENNFGANFNVDEIKVHQLMNDHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGE 95 A +++ F EI+V + +N H N + ++ + I++D D DL E ++ G Sbjct: 28 APDDYLTKFLPREIQVMKHLN-HSNVVSLHEAIETSSRIYIILDLADNGDLLEYIRSNGA 86 Query: 94 LSHQLVSNIIRQLCEALNDLHKHNFIHNDIK 2 + QL +A+ LH +H D+K Sbjct: 87 IPENEARLFYHQLVDAVEYLHNKGVVHRDLK 117 >SB_17500| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 366 Score = 37.5 bits (83), Expect = 0.013 Identities = 19/69 (27%), Positives = 32/69 (46%) Frame = -3 Query: 208 HPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQLCEALNDLHK 29 H N + +Y + ++M+Y+ LF+ + + S + + RQL AL LH Sbjct: 85 HENIVSLYSSIREGETVCLIMEYVAGGSLFDEVIQQTYYSEKQARLVTRQLLNALEYLHS 144 Query: 28 HNFIHNDIK 2 +H DIK Sbjct: 145 RRIVHRDIK 153 >SB_36983| Best HMM Match : Pkinase (HMM E-Value=6.4e-22) Length = 331 Score = 37.5 bits (83), Expect = 0.013 Identities = 22/75 (29%), Positives = 36/75 (48%), Gaps = 5/75 (6%) Frame = -3 Query: 211 DHPNFIKIYFNHGFIN--NQVIVMDYIDCPDLFETLQIKGE---LSHQLVSNIIRQLCEA 47 DH N +KI+ + + N++IVM+ LF L+ LS Q +IR + Sbjct: 65 DHENIVKIFASETELRSQNEIIVMELCSGGSLFTMLEHPSNAYGLSEQDCIAVIRDVVAG 124 Query: 46 LNDLHKHNFIHNDIK 2 + LH + +H D+K Sbjct: 125 MKHLHDNGIVHRDLK 139 >SB_11825| Best HMM Match : Pkinase (HMM E-Value=1.2e-17) Length = 181 Score = 36.7 bits (81), Expect = 0.022 Identities = 20/79 (25%), Positives = 41/79 (51%) Frame = -3 Query: 238 EIKVHQLMNDHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQ 59 EI + M+ H + + + N V++M++I +LFE + + L+ + + + Q Sbjct: 46 EIDIMSRMH-HKRLVGLLDAYDANRNIVMIMEFISGGELFERVVDEDCLTEKEAAYYMHQ 104 Query: 58 LCEALNDLHKHNFIHNDIK 2 L + + +HK N +H D+K Sbjct: 105 LLQGIEHVHKKNVLHLDLK 123 >SB_18299| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 698 Score = 36.7 bits (81), Expect = 0.022 Identities = 17/51 (33%), Positives = 30/51 (58%) Frame = -3 Query: 154 IVMDYIDCPDLFETLQIKGELSHQLVSNIIRQLCEALNDLHKHNFIHNDIK 2 +VM+ + DLFE + + + S+++R L AL+ LH ++ +H DIK Sbjct: 93 LVMELVKGGDLFEAIVEATKYTEVHASHMVRDLASALDYLHCNSIVHRDIK 143 >SB_12255| Best HMM Match : Pkinase (HMM E-Value=0) Length = 476 Score = 36.7 bits (81), Expect = 0.022 Identities = 17/69 (24%), Positives = 35/69 (50%) Frame = -3 Query: 208 HPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQLCEALNDLHK 29 HPN ++++ N +V D + +LFE + + S S+ I+Q+ ++ H+ Sbjct: 73 HPNVVRLHANIMSDGFYFLVFDLVTGGELFEDIVAREYYSEADASHCIQQVLLSVQHCHE 132 Query: 28 HNFIHNDIK 2 + +H D+K Sbjct: 133 NGIVHRDLK 141 >SB_46550| Best HMM Match : Asn_synthase (HMM E-Value=0) Length = 1663 Score = 36.3 bits (80), Expect = 0.029 Identities = 20/79 (25%), Positives = 38/79 (48%) Frame = -3 Query: 238 EIKVHQLMNDHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQ 59 E+ V +++ HPN + N +IV + + LF+ L + L+ ++ + Q Sbjct: 1137 EVTVLRMLK-HPNLCIFLDAYDTPKNYIIVTELLAGGRLFDYLVVMDALTEKVAIGYMHQ 1195 Query: 58 LCEALNDLHKHNFIHNDIK 2 + E + LH N +H D+K Sbjct: 1196 VVEGVQHLHDLNIVHLDLK 1214 >SB_59029| Best HMM Match : Pkinase (HMM E-Value=0) Length = 1023 Score = 35.9 bits (79), Expect = 0.039 Identities = 23/81 (28%), Positives = 42/81 (51%), Gaps = 2/81 (2%) Frame = -3 Query: 238 EIKVHQLMNDHPNFIKIYFNHGFIN--NQVIVMDYIDCPDLFETLQIKGELSHQLVSNII 65 EI++H+ + H + F+ F + N I+++ L + L+ +G+L+ V + Sbjct: 481 EIELHRTLRHH---YVVGFHGSFQDEMNFYILLELCSRKSLVQMLKTRGKLTEPEVRFFM 537 Query: 64 RQLCEALNDLHKHNFIHNDIK 2 +Q EA + LH+ IH DIK Sbjct: 538 QQAIEACSYLHEQRVIHRDIK 558 >SB_31698| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 468 Score = 35.5 bits (78), Expect = 0.051 Identities = 12/52 (23%), Positives = 31/52 (59%) Frame = -3 Query: 157 VIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQLCEALNDLHKHNFIHNDIK 2 +++M+++ +LFE + L+ + V +RQ+ + + +H+ + +H D+K Sbjct: 124 IVIMEFVSGGELFEKICNDDNLTEKEVIRYMRQILQGVEHMHRKSIVHLDLK 175 >SB_28982| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1287 Score = 35.5 bits (78), Expect = 0.051 Identities = 20/83 (24%), Positives = 46/83 (55%), Gaps = 1/83 (1%) Frame = -3 Query: 247 NVDEIKVHQLMNDHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGEL-SHQLVSN 71 N+ E+K + ++ H N +K+ ++ V +Y+ +L++ ++ + +L ++ N Sbjct: 13 NLREVKSLRKLS-HTNIVKLKEVIRENDHLYFVFEYMK-ENLYQMMKNRDKLLPESVIRN 70 Query: 70 IIRQLCEALNDLHKHNFIHNDIK 2 +I Q+ + L +HKH + H D+K Sbjct: 71 VIYQILQGLAFIHKHGYFHRDMK 93 >SB_18697| Best HMM Match : Pkinase (HMM E-Value=5.9e-07) Length = 216 Score = 35.5 bits (78), Expect = 0.051 Identities = 16/52 (30%), Positives = 30/52 (57%) Frame = -3 Query: 157 VIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQLCEALNDLHKHNFIHNDIK 2 VI+MD ++ + E L K + + + ++RQ +AL LH +N +H D++ Sbjct: 116 VIMMDIVEGKNCLEFLGDKPRANEEDAAFVMRQTLDALKYLHSNNIVHLDVR 167 >SB_37647| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 666 Score = 35.5 bits (78), Expect = 0.051 Identities = 26/86 (30%), Positives = 43/86 (50%), Gaps = 9/86 (10%) Frame = -3 Query: 232 KVHQLMN-DHPNFIKIYFNHGFINNQ-----VIVMDY-IDCPDLFETLQI--KGELSHQL 80 +VH L H N I++ ++ ++N+ VIVM+ C DLF L+I +G + + Sbjct: 459 EVHYLRKCHHVNIIELLAHYIMLDNEQTSRHVIVMERPAHCLDLFSFLEIQPRGRVKEKG 518 Query: 79 VSNIIRQLCEALNDLHKHNFIHNDIK 2 I R + + L + +HNDIK Sbjct: 519 ARKIFRDVMRGVKYLDQRGILHNDIK 544 >SB_33732| Best HMM Match : Pkinase (HMM E-Value=9e-10) Length = 322 Score = 35.1 bits (77), Expect = 0.068 Identities = 19/70 (27%), Positives = 37/70 (52%), Gaps = 1/70 (1%) Frame = -3 Query: 208 HPNFIKIYFNHGFINNQV-IVMDYIDCPDLFETLQIKGELSHQLVSNIIRQLCEALNDLH 32 H N +++ F + + + +V ++++Y +L++ L + + + IRQL +AL H Sbjct: 86 HNNILRL-FGYFYDDTRVYLILEYAPRGELYKELTACEKFDEKRAAKYIRQLADALAYCH 144 Query: 31 KHNFIHNDIK 2 IH DIK Sbjct: 145 SKKVIHRDIK 154 >SB_57581| Best HMM Match : Pkinase (HMM E-Value=4.7e-24) Length = 235 Score = 35.1 bits (77), Expect = 0.068 Identities = 15/48 (31%), Positives = 27/48 (56%) Frame = -3 Query: 145 DYIDCPDLFETLQIKGELSHQLVSNIIRQLCEALNDLHKHNFIHNDIK 2 D + +LF+ + KG + Q S +++Q+ EA + LH +H D+K Sbjct: 89 DSVQGGELFDRIVEKGNYTEQDASALVQQILEAADYLHSLGIVHRDLK 136 >SB_32519| Best HMM Match : Pkinase (HMM E-Value=7.3e-39) Length = 1486 Score = 34.7 bits (76), Expect = 0.090 Identities = 21/79 (26%), Positives = 36/79 (45%) Frame = -3 Query: 238 EIKVHQLMNDHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQ 59 E ++ Q++ HP+ I + N +V + DL + + + L V IRQ Sbjct: 230 EARILQMVR-HPHIISLLEVVETENRYYLVFELAGGGDLMDYICYRKRLGETEVRKFIRQ 288 Query: 58 LCEALNDLHKHNFIHNDIK 2 + A+ LH+ IH D+K Sbjct: 289 IISAVQYLHQGGIIHRDLK 307 >SB_22253| Best HMM Match : Pkinase (HMM E-Value=0) Length = 870 Score = 34.7 bits (76), Expect = 0.090 Identities = 14/51 (27%), Positives = 27/51 (52%) Frame = -3 Query: 154 IVMDYIDCPDLFETLQIKGELSHQLVSNIIRQLCEALNDLHKHNFIHNDIK 2 +V +++D L + + L V ++ Q+ A+ +H+HN IH D+K Sbjct: 22 LVFEFVDHTVLDDLERYPNGLDENTVRKVMWQVLRAIEFIHRHNIIHRDVK 72 >SB_31870| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1378 Score = 33.9 bits (74), Expect = 0.16 Identities = 22/82 (26%), Positives = 43/82 (52%), Gaps = 1/82 (1%) Frame = -3 Query: 244 VDEIKVHQLMNDHPNFIKIYFNHGFINNQV-IVMDYIDCPDLFETLQIKGELSHQLVSNI 68 ++EI V + N HPN + Y + + ++ +VM+Y+ L + + + + ++ + Sbjct: 265 INEILVMR-ENKHPNIVN-YVDSYLVGEELWVVMEYLAGGSLTDVVT-ETCMDEGQIAAV 321 Query: 67 IRQLCEALNDLHKHNFIHNDIK 2 R+ +AL LH + IH DIK Sbjct: 322 CRECLQALEFLHSNGVIHRDIK 343 >SB_11460| Best HMM Match : Pkinase (HMM E-Value=0) Length = 323 Score = 33.9 bits (74), Expect = 0.16 Identities = 13/51 (25%), Positives = 27/51 (52%) Frame = -3 Query: 154 IVMDYIDCPDLFETLQIKGELSHQLVSNIIRQLCEALNDLHKHNFIHNDIK 2 I+ D + DL E ++ G L+ + + RQ+ ++ +H + +H D+K Sbjct: 127 IITDLAENGDLLEYIRTHGALTEKASRRLFRQITAGVHYIHSQDIVHRDLK 177 >SB_37321| Best HMM Match : Pkinase (HMM E-Value=2.4e-27) Length = 592 Score = 33.1 bits (72), Expect = 0.27 Identities = 13/30 (43%), Positives = 20/30 (66%) Frame = -3 Query: 91 SHQLVSNIIRQLCEALNDLHKHNFIHNDIK 2 S + V ++RQ+ E + LHK N++H DIK Sbjct: 250 SEKEVVYLLRQILEGIRHLHKQNYVHLDIK 279 >SB_25723| Best HMM Match : Vicilin_N (HMM E-Value=0.0045) Length = 2506 Score = 32.7 bits (71), Expect = 0.36 Identities = 16/58 (27%), Positives = 32/58 (55%) Frame = +3 Query: 519 AEAQIIKDSIYDNTVLLNRDVFLNILKFANDVFDNKAYMYVDDSEVSRYYNAVVKMKR 692 AE +I ++ ++ V ++ +V L+ +F ND+ DN AY V + + Y++ +R Sbjct: 1093 AEIEIEEEDSSEHEVYMDENVVLHAARFVNDIIDN-AYDIVKEEMIHDYFHPSSNRRR 1149 >SB_17930| Best HMM Match : Pkinase (HMM E-Value=0) Length = 286 Score = 32.7 bits (71), Expect = 0.36 Identities = 19/79 (24%), Positives = 36/79 (45%) Frame = -3 Query: 238 EIKVHQLMNDHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQ 59 E V + ++HP + ++ + V++Y+ DL +Q + L + Sbjct: 73 EKHVFEQASNHPFLVGLHSCFQTSSRLFFVIEYVSGGDLMYHMQRQRRLPEDHARFYSAE 132 Query: 58 LCEALNDLHKHNFIHNDIK 2 +C ALN LH+ I+ D+K Sbjct: 133 ICCALNFLHEKGVIYRDLK 151 >SB_9887| Best HMM Match : Pkinase (HMM E-Value=4.1e-37) Length = 256 Score = 32.7 bits (71), Expect = 0.36 Identities = 17/65 (26%), Positives = 32/65 (49%) Frame = -3 Query: 196 IKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQLCEALNDLHKHNFI 17 +K+Y++ +VM+++ DL L K + + I + A++ +H+ FI Sbjct: 111 VKMYYSFQDDYYLFLVMEFLPGGDLMTLLMKKDTFTEEETRFYIAEALLAIDSIHQLGFI 170 Query: 16 HNDIK 2 H DIK Sbjct: 171 HRDIK 175 >SB_26383| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1142 Score = 32.3 bits (70), Expect = 0.48 Identities = 14/37 (37%), Positives = 21/37 (56%) Frame = -3 Query: 112 LQIKGELSHQLVSNIIRQLCEALNDLHKHNFIHNDIK 2 L+++ L+ + + RQL E L LH H IH D+K Sbjct: 320 LELERGLNEPEIRAVTRQLFEGLQFLHNHKVIHRDLK 356 >SB_18269| Best HMM Match : CUB (HMM E-Value=7.4e-37) Length = 1655 Score = 31.9 bits (69), Expect = 0.63 Identities = 23/69 (33%), Positives = 36/69 (52%), Gaps = 1/69 (1%) Frame = -3 Query: 208 HPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIK-GELSHQLVSNIIRQLCEALNDLH 32 +P+F KI H ++ ++ D++ L L+ K GELS V + L +AL +LH Sbjct: 1512 NPSFPKI--KH---DSLLLCFDFVSNTTLDAFLREKEGELSLDCVCAVAIDLSDALIELH 1566 Query: 31 KHNFIHNDI 5 H +HN I Sbjct: 1567 NHGVVHNAI 1575 >SB_26967| Best HMM Match : Pkinase (HMM E-Value=0) Length = 428 Score = 31.9 bits (69), Expect = 0.63 Identities = 20/81 (24%), Positives = 36/81 (44%), Gaps = 12/81 (14%) Frame = -3 Query: 208 HPNFIKIYFNHGFINNQVIVMDYIDCPDLFE------------TLQIKGELSHQLVSNII 65 HP+ IK+Y + +VM+Y+ +LFE T K +L + Sbjct: 77 HPHIIKLYQVISTPTDIFMVMEYVSGGELFEYILKHGKVQCDKTSHFKVQLEEKDARRFF 136 Query: 64 RQLCEALNDLHKHNFIHNDIK 2 +Q+ ++ H+H +H D+K Sbjct: 137 QQIISGVDYCHRHMVVHRDLK 157 >SB_25818| Best HMM Match : Pkinase (HMM E-Value=1.7e-20) Length = 956 Score = 31.9 bits (69), Expect = 0.63 Identities = 10/34 (29%), Positives = 21/34 (61%) Frame = -3 Query: 103 KGELSHQLVSNIIRQLCEALNDLHKHNFIHNDIK 2 +G L +++ ++R++ + L HK+ IH D+K Sbjct: 797 EGVLEEDIIATVLREVLKGLEYFHKNGLIHRDVK 830 >SB_21523| Best HMM Match : Pkinase (HMM E-Value=9.5e-14) Length = 322 Score = 31.1 bits (67), Expect = 1.1 Identities = 15/55 (27%), Positives = 27/55 (49%) Frame = -3 Query: 166 NNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQLCEALNDLHKHNFIHNDIK 2 N+ ++M+Y DL + K L ++ +RQL AL + ++ H D+K Sbjct: 128 NHIFLIMEYCGGGDLSRFIHSKRALPERMARKFLRQLACALQYMRSYDVAHMDLK 182 >SB_34086| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 890 Score = 31.1 bits (67), Expect = 1.1 Identities = 12/36 (33%), Positives = 21/36 (58%) Frame = -3 Query: 109 QIKGELSHQLVSNIIRQLCEALNDLHKHNFIHNDIK 2 Q KG SH + + Q+ +++ +H+ F+H DIK Sbjct: 15 QPKGVFSHSTMLRLGTQILKSVKSIHEAGFLHRDIK 50 >SB_28695| Best HMM Match : Ras (HMM E-Value=0) Length = 1058 Score = 31.1 bits (67), Expect = 1.1 Identities = 14/51 (27%), Positives = 26/51 (50%) Frame = -3 Query: 154 IVMDYIDCPDLFETLQIKGELSHQLVSNIIRQLCEALNDLHKHNFIHNDIK 2 I M+++ + + L+ G + RQ+ + ++ LH +N IH DIK Sbjct: 256 IFMEFVPGGSIAQALKRFGAFVEPVFRRYTRQILDGVSYLHNNNVIHRDIK 306 >SB_41851| Best HMM Match : Pkinase (HMM E-Value=0) Length = 967 Score = 30.7 bits (66), Expect = 1.5 Identities = 18/81 (22%), Positives = 38/81 (46%) Frame = -3 Query: 244 VDEIKVHQLMNDHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNII 65 +DEI + + HP+ IK + I ++++ + L G ++ + Sbjct: 663 MDEIAILARLK-HPHLIKCLGATRHTGHFNIFLEWMAGGSISMLLSKYGPFEEAILIRYL 721 Query: 64 RQLCEALNDLHKHNFIHNDIK 2 RQ+ + ++ LH++ +H DIK Sbjct: 722 RQILQGVSYLHENQVVHRDIK 742 >SB_48446| Best HMM Match : Pkinase (HMM E-Value=1.2e-05) Length = 228 Score = 30.3 bits (65), Expect = 1.9 Identities = 14/39 (35%), Positives = 22/39 (56%) Frame = -3 Query: 118 ETLQIKGELSHQLVSNIIRQLCEALNDLHKHNFIHNDIK 2 + L+ KG L + V + Q+ + L+ LH N IH D+K Sbjct: 18 QLLRDKGPLVEETVRQYVWQILKGLSFLHGVNIIHRDLK 56 >SB_47948| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 641 Score = 30.3 bits (65), Expect = 1.9 Identities = 23/83 (27%), Positives = 42/83 (50%), Gaps = 4/83 (4%) Frame = -3 Query: 238 EIKVH-QLMNDHPNFIKIYFNHGFINNQVIVMDYID-CP--DLFETLQIKGELSHQLVSN 71 EI++H ++M+ H I HG+ ++ + ++ CP L E + + L+ V Sbjct: 88 EIEIHGKVMHKH-----IVGFHGYFEDRDYIYILLELCPRRSLMELHKRRRALTEPEVRY 142 Query: 70 IIRQLCEALNDLHKHNFIHNDIK 2 ++Q+ +A LHK IH D+K Sbjct: 143 FMKQIIDACIYLHKSRIIHRDLK 165 >SB_8812| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 604 Score = 29.9 bits (64), Expect = 2.6 Identities = 18/66 (27%), Positives = 28/66 (42%), Gaps = 4/66 (6%) Frame = -3 Query: 208 HPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGE----LSHQLVSNIIRQLCEALN 41 H N I++Y + +VM+Y DL + + + + L N RQL E + Sbjct: 110 HHNVIQLYETFHTCHKIFLVMEYAAKGDLLDYINSRCRRCVGIGEDLAKNFFRQLTEGIM 169 Query: 40 DLHKHN 23 HK N Sbjct: 170 HCHKRN 175 >SB_32748| Best HMM Match : Pkinase (HMM E-Value=7.8e-26) Length = 187 Score = 29.9 bits (64), Expect = 2.6 Identities = 15/51 (29%), Positives = 24/51 (47%) Frame = -3 Query: 154 IVMDYIDCPDLFETLQIKGELSHQLVSNIIRQLCEALNDLHKHNFIHNDIK 2 +VM+Y++ D L+ G L L + A+ LH + +H DIK Sbjct: 34 MVMEYVEGGDCASLLKNIGALPADLARMYFAETVLAVEYLHSYGIVHRDIK 84 >SB_46497| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 64 Score = 29.5 bits (63), Expect = 3.4 Identities = 13/36 (36%), Positives = 19/36 (52%) Frame = -3 Query: 109 QIKGELSHQLVSNIIRQLCEALNDLHKHNFIHNDIK 2 + KG L L + +A+ +H + FIHNDIK Sbjct: 10 EYKGPLPEDLYIPFTTDILKAVEFMHGNGFIHNDIK 45 >SB_38378| Best HMM Match : Pkinase_Tyr (HMM E-Value=0) Length = 478 Score = 29.5 bits (63), Expect = 3.4 Identities = 10/25 (40%), Positives = 17/25 (68%) Frame = -3 Query: 79 VSNIIRQLCEALNDLHKHNFIHNDI 5 ++ ++RQ+ A+ L HNFIH D+ Sbjct: 309 MTEMVRQVAAAMKYLESHNFIHRDL 333 >SB_25790| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 29.5 bits (63), Expect = 3.4 Identities = 13/41 (31%), Positives = 21/41 (51%) Frame = -3 Query: 124 LFETLQIKGELSHQLVSNIIRQLCEALNDLHKHNFIHNDIK 2 + E ++ G L+ L RQ+ E + LH + +H DIK Sbjct: 3 IHEHIKQHGALNESLTRKYSRQILEGILYLHTNRIVHRDIK 43 >SB_19466| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 74 Score = 29.5 bits (63), Expect = 3.4 Identities = 13/36 (36%), Positives = 19/36 (52%) Frame = -3 Query: 109 QIKGELSHQLVSNIIRQLCEALNDLHKHNFIHNDIK 2 + KG L L + +A+ +H + FIHNDIK Sbjct: 10 EYKGPLPEDLYIPFTTDILKAVEFMHGNGFIHNDIK 45 >SB_48455| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 622 Score = 29.1 bits (62), Expect = 4.5 Identities = 15/50 (30%), Positives = 27/50 (54%), Gaps = 1/50 (2%) Frame = -3 Query: 148 MDYID-CPDLFETLQIKGELSHQLVSNIIRQLCEALNDLHKHNFIHNDIK 2 MD D C ++ + S + S+ +RQ+ EA++ H++ IH D+K Sbjct: 1 MDGADLCFEIVNRVNAGFVYSEAVASHYMRQVLEAVSFCHENGIIHRDLK 50 >SB_35776| Best HMM Match : Pkinase (HMM E-Value=0) Length = 558 Score = 29.1 bits (62), Expect = 4.5 Identities = 14/52 (26%), Positives = 27/52 (51%), Gaps = 1/52 (1%) Frame = -3 Query: 154 IVMDYIDCPDLFETLQIKGELSHQLVSNI-IRQLCEALNDLHKHNFIHNDIK 2 +VMDY DL L ++ + ++ + ++ A++ LH F+H D+K Sbjct: 156 LVMDYHPGGDLLSLLSKYDDIFEEDMARFYLAEIVMAIHSLHTMGFVHRDVK 207 >SB_11202| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1822 Score = 29.1 bits (62), Expect = 4.5 Identities = 13/51 (25%), Positives = 25/51 (49%) Frame = -3 Query: 154 IVMDYIDCPDLFETLQIKGELSHQLVSNIIRQLCEALNDLHKHNFIHNDIK 2 I M+Y + L + + + + V ++R++ E L +H IH D+K Sbjct: 1051 IQMEYCEKSTLRDVIDMGLHTNTDRVWRLLREIVEGLAHIHSQGIIHRDLK 1101 >SB_54907| Best HMM Match : Pkinase (HMM E-Value=1.4e-10) Length = 251 Score = 28.7 bits (61), Expect = 5.9 Identities = 13/37 (35%), Positives = 20/37 (54%) Frame = -1 Query: 369 NCKNVKTRYKIINGRFGKISILSHKPTSKLYLQKTIS 259 N + KT I G FG++ ++ H T K+Y K +S Sbjct: 68 NNDDFKTLKVIGRGAFGEVQLVRHTHTKKVYAMKLLS 104 >SB_46109| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 386 Score = 28.7 bits (61), Expect = 5.9 Identities = 20/61 (32%), Positives = 31/61 (50%), Gaps = 2/61 (3%) Frame = -1 Query: 423 GHHHRHKCTLQ--TLVQFYENCKNVKTRYKIINGRFGKISILSHKPTSKLYLQKTISAPI 250 GH H+ L+ +Q++++CK KTR II + K S H+ S L L + S I Sbjct: 259 GHRHQGYGHLRFTKAMQYFKDCKISKTRL-IIQNQERKTSCFKHRFRSNLLLLRGFSTFI 317 Query: 249 L 247 + Sbjct: 318 I 318 >SB_36661| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 463 Score = 28.7 bits (61), Expect = 5.9 Identities = 10/25 (40%), Positives = 15/25 (60%) Frame = -3 Query: 76 SNIIRQLCEALNDLHKHNFIHNDIK 2 S ++ +C AL+ LHK H D+K Sbjct: 196 SLVVNDICSALDFLHKQGIAHRDLK 220 >SB_31696| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 548 Score = 28.7 bits (61), Expect = 5.9 Identities = 13/46 (28%), Positives = 27/46 (58%) Frame = -3 Query: 139 IDCPDLFETLQIKGELSHQLVSNIIRQLCEALNDLHKHNFIHNDIK 2 +D D+ + + K +++ + + +IR + AL LH+ N +H DI+ Sbjct: 126 LDGEDVLKFMSSKTKVTEEDAALVIRGILNALCYLHELNIVHLDIR 171 >SB_10682| Best HMM Match : Pkinase (HMM E-Value=2.5e-07) Length = 165 Score = 28.7 bits (61), Expect = 5.9 Identities = 22/72 (30%), Positives = 34/72 (47%), Gaps = 2/72 (2%) Frame = -3 Query: 211 DHPNFIKIYFNHGFINNQVI--VMDYIDCPDLFETLQIKGELSHQLVSNIIRQLCEALND 38 DH N +K+ N++ I V +Y+D DL ++ L I+ QL +A Sbjct: 26 DHENVVKLMNVIKADNDKDIYLVFEYMDT-DLHNVIKRGNILKDIHKRYIMYQLLKATKF 84 Query: 37 LHKHNFIHNDIK 2 +H N IH D+K Sbjct: 85 IHSGNVIHRDLK 96 >SB_4038| Best HMM Match : v110 (HMM E-Value=5.5) Length = 228 Score = 28.7 bits (61), Expect = 5.9 Identities = 14/41 (34%), Positives = 21/41 (51%) Frame = -3 Query: 469 Y*INKIVQIHIYDSSWPPPPPQMYAANAGTILRKLQKRQNS 347 Y +IV+I +YD + P PP + AN IL +R + Sbjct: 133 YSFRRIVKIRLYDCTLPWPPQFVGEANGRNILSDWHRRSGA 173 >SB_58974| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1831 Score = 28.3 bits (60), Expect = 7.8 Identities = 14/40 (35%), Positives = 20/40 (50%) Frame = -1 Query: 402 CTLQTLVQFYENCKNVKTRYKIINGRFGKISILSHKPTSK 283 C L L + + + YKI++G KIS S PT+K Sbjct: 1062 CDLSCLTLYPDGTYTIAPNYKIVDGTCVKISPTSITPTTK 1101 >SB_25040| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 456 Score = 28.3 bits (60), Expect = 7.8 Identities = 18/79 (22%), Positives = 35/79 (44%) Frame = -3 Query: 238 EIKVHQLMNDHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQ 59 E +V L HP ++ ++ VM+Y++ DL +Q +G+ + + Sbjct: 335 ERRVLALATRHPFLTHLHSAFQSADHLFFVMEYLNGGDLMFHIQNQGKFDEKRSRFYAAE 394 Query: 58 LCEALNDLHKHNFIHNDIK 2 + L LH+ I+ D+K Sbjct: 395 IVCGLQFLHELGIIYRDLK 413 >SB_10408| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 272 Score = 28.3 bits (60), Expect = 7.8 Identities = 14/40 (35%), Positives = 20/40 (50%) Frame = -1 Query: 441 IFTIRHGHHHRHKCTLQTLVQFYENCKNVKTRYKIINGRF 322 I IRH HHH K + +V Y+N +N + I R+ Sbjct: 38 IIKIRH-HHHLSKSSKSVIVIIYQNYQNPSSSSSFIKIRY 76 >SB_5779| Best HMM Match : Pkinase (HMM E-Value=1.8e-19) Length = 284 Score = 28.3 bits (60), Expect = 7.8 Identities = 11/42 (26%), Positives = 21/42 (50%) Frame = -3 Query: 127 DLFETLQIKGELSHQLVSNIIRQLCEALNDLHKHNFIHNDIK 2 +LFE ++ K + + +++ +AL H N H D+K Sbjct: 5 ELFEQIRKKRRFTEKEAMKFTKEIAQALYHCHSFNVAHRDLK 46 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 22,211,757 Number of Sequences: 59808 Number of extensions: 448293 Number of successful extensions: 1548 Number of sequences better than 10.0: 67 Number of HSP's better than 10.0 without gapping: 1389 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1539 length of database: 16,821,457 effective HSP length: 81 effective length of database: 11,977,009 effective search space used: 2251677692 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -