BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV120043.Seq (810 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AB244761-1|BAE66603.1| 504|Apis mellifera cystathionine beta-sy... 24 1.4 AF469010-1|AAL93136.1| 678|Apis mellifera cGMP-dependent protei... 24 1.9 EF625896-1|ABR45903.1| 683|Apis mellifera hexamerin protein. 23 2.5 AY601637-1|AAT11850.1| 683|Apis mellifera hexamerin 70b protein. 23 2.5 DQ325102-1|ABD14116.1| 183|Apis mellifera complementary sex det... 23 3.3 DQ325101-1|ABD14115.1| 182|Apis mellifera complementary sex det... 23 3.3 DQ325100-1|ABD14114.1| 183|Apis mellifera complementary sex det... 23 3.3 DQ325099-1|ABD14113.1| 183|Apis mellifera complementary sex det... 23 3.3 DQ325098-1|ABD14112.1| 183|Apis mellifera complementary sex det... 23 3.3 DQ325097-1|ABD14111.1| 183|Apis mellifera complementary sex det... 23 3.3 DQ325096-1|ABD14110.1| 183|Apis mellifera complementary sex det... 23 3.3 DQ325095-1|ABD14109.1| 183|Apis mellifera complementary sex det... 23 3.3 Z26318-1|CAA81227.1| 544|Apis mellifera royal jelly protein RJP... 22 5.8 >AB244761-1|BAE66603.1| 504|Apis mellifera cystathionine beta-synthase protein. Length = 504 Score = 24.2 bits (50), Expect = 1.4 Identities = 7/19 (36%), Positives = 12/19 (63%) Frame = +2 Query: 389 VCSVHLWRWWWP*RIVNMN 445 VC + +WWW +I N++ Sbjct: 358 VCQNEMNKWWWNMKISNLS 376 >AF469010-1|AAL93136.1| 678|Apis mellifera cGMP-dependent protein kinase foraging protein. Length = 678 Score = 23.8 bits (49), Expect = 1.9 Identities = 12/42 (28%), Positives = 19/42 (45%) Frame = -3 Query: 127 DLFETLQIKGELSHQLVSNIIRQLCEALNDLHKHNFIHNDIK 2 +L+ L+ KG + EA + LH N I+ D+K Sbjct: 452 ELWTVLRDKGHFDDGTTRFYTACVVEAFDYLHSRNIIYRDLK 493 >EF625896-1|ABR45903.1| 683|Apis mellifera hexamerin protein. Length = 683 Score = 23.4 bits (48), Expect = 2.5 Identities = 10/21 (47%), Positives = 14/21 (66%) Frame = +2 Query: 515 YCGSANYQRQHLRQHSVAEQR 577 Y +ANY +L +H+V EQR Sbjct: 198 YLLAANYTGWYLTKHNVPEQR 218 >AY601637-1|AAT11850.1| 683|Apis mellifera hexamerin 70b protein. Length = 683 Score = 23.4 bits (48), Expect = 2.5 Identities = 10/21 (47%), Positives = 14/21 (66%) Frame = +2 Query: 515 YCGSANYQRQHLRQHSVAEQR 577 Y +ANY +L +H+V EQR Sbjct: 198 YLLAANYTGWYLTKHNVPEQR 218 >DQ325102-1|ABD14116.1| 183|Apis mellifera complementary sex determiner protein. Length = 183 Score = 23.0 bits (47), Expect = 3.3 Identities = 8/29 (27%), Positives = 16/29 (55%) Frame = -3 Query: 253 NFNVDEIKVHQLMNDHPNFIKIYFNHGFI 167 N+N + N++ N+ K+Y+N +I Sbjct: 88 NYNYSNYNNYNNNNNYNNYKKLYYNINYI 116 >DQ325101-1|ABD14115.1| 182|Apis mellifera complementary sex determiner protein. Length = 182 Score = 23.0 bits (47), Expect = 3.3 Identities = 8/29 (27%), Positives = 16/29 (55%) Frame = -3 Query: 253 NFNVDEIKVHQLMNDHPNFIKIYFNHGFI 167 N+N + N++ N+ K+Y+N +I Sbjct: 88 NYNYSNYNNYNNNNNYNNYKKLYYNINYI 116 >DQ325100-1|ABD14114.1| 183|Apis mellifera complementary sex determiner protein. Length = 183 Score = 23.0 bits (47), Expect = 3.3 Identities = 8/29 (27%), Positives = 16/29 (55%) Frame = -3 Query: 253 NFNVDEIKVHQLMNDHPNFIKIYFNHGFI 167 N+N + N++ N+ K+Y+N +I Sbjct: 88 NYNYSNYNNYNNNNNYNNYKKLYYNINYI 116 >DQ325099-1|ABD14113.1| 183|Apis mellifera complementary sex determiner protein. Length = 183 Score = 23.0 bits (47), Expect = 3.3 Identities = 8/29 (27%), Positives = 16/29 (55%) Frame = -3 Query: 253 NFNVDEIKVHQLMNDHPNFIKIYFNHGFI 167 N+N + N++ N+ K+Y+N +I Sbjct: 88 NYNYSNYNNYNNNNNYNNYKKLYYNINYI 116 >DQ325098-1|ABD14112.1| 183|Apis mellifera complementary sex determiner protein. Length = 183 Score = 23.0 bits (47), Expect = 3.3 Identities = 8/29 (27%), Positives = 16/29 (55%) Frame = -3 Query: 253 NFNVDEIKVHQLMNDHPNFIKIYFNHGFI 167 N+N + N++ N+ K+Y+N +I Sbjct: 88 NYNYSNYNNYNNNNNYNNYKKLYYNINYI 116 >DQ325097-1|ABD14111.1| 183|Apis mellifera complementary sex determiner protein. Length = 183 Score = 23.0 bits (47), Expect = 3.3 Identities = 8/29 (27%), Positives = 16/29 (55%) Frame = -3 Query: 253 NFNVDEIKVHQLMNDHPNFIKIYFNHGFI 167 N+N + N++ N+ K+Y+N +I Sbjct: 88 NYNYSNYNNYNNNNNYNNYKKLYYNINYI 116 >DQ325096-1|ABD14110.1| 183|Apis mellifera complementary sex determiner protein. Length = 183 Score = 23.0 bits (47), Expect = 3.3 Identities = 8/29 (27%), Positives = 16/29 (55%) Frame = -3 Query: 253 NFNVDEIKVHQLMNDHPNFIKIYFNHGFI 167 N+N + N++ N+ K+Y+N +I Sbjct: 88 NYNYSNYNNYNNNNNYNNYKKLYYNINYI 116 >DQ325095-1|ABD14109.1| 183|Apis mellifera complementary sex determiner protein. Length = 183 Score = 23.0 bits (47), Expect = 3.3 Identities = 8/29 (27%), Positives = 16/29 (55%) Frame = -3 Query: 253 NFNVDEIKVHQLMNDHPNFIKIYFNHGFI 167 N+N + N++ N+ K+Y+N +I Sbjct: 88 NYNYSNYNNYNNNNNYNNYKKLYYNINYI 116 >Z26318-1|CAA81227.1| 544|Apis mellifera royal jelly protein RJP57-1 protein. Length = 544 Score = 22.2 bits (45), Expect = 5.8 Identities = 7/24 (29%), Positives = 15/24 (62%) Frame = -1 Query: 375 YENCKNVKTRYKIINGRFGKISIL 304 YE+C + + +KI +F ++ +L Sbjct: 121 YEDCSGIVSAFKIAVDKFDRLWVL 144 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 211,948 Number of Sequences: 438 Number of extensions: 4687 Number of successful extensions: 16 Number of sequences better than 10.0: 13 Number of HSP's better than 10.0 without gapping: 16 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 16 length of database: 146,343 effective HSP length: 57 effective length of database: 121,377 effective search space used: 25731924 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -