BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV120042.Seq (745 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ011226-1|AAY63895.1| 471|Apis mellifera Rh-like protein protein. 23 2.3 AY921573-1|AAX62923.1| 694|Apis mellifera D2-like dopamine rece... 23 3.0 AY569719-1|AAS86672.1| 401|Apis mellifera feminizer protein. 23 4.0 AY569718-1|AAS86671.1| 401|Apis mellifera feminizer protein. 23 4.0 AY569715-1|AAS86668.1| 401|Apis mellifera feminizer protein. 23 4.0 AY569714-1|AAS86667.1| 401|Apis mellifera feminizer protein. 23 4.0 AY569713-1|AAS86666.1| 401|Apis mellifera feminizer protein. 23 4.0 AY569711-1|AAS86664.1| 401|Apis mellifera feminizer protein. 23 4.0 AY569702-1|AAS86655.1| 400|Apis mellifera feminizer protein. 23 4.0 AY350616-1|AAQ57658.1| 401|Apis mellifera complementary sex det... 23 4.0 AB022908-1|BAA86909.1| 493|Apis mellifera amylase protein. 23 4.0 DQ342041-1|ABC69933.1| 828|Apis mellifera STIP protein. 22 5.3 DQ435324-1|ABD92639.1| 152|Apis mellifera OBP3 protein. 22 7.0 AB269871-1|BAF03050.1| 1923|Apis mellifera cell adhesion molecul... 22 7.0 AB257298-1|BAE93381.1| 1919|Apis mellifera Dscam family member A... 22 7.0 >DQ011226-1|AAY63895.1| 471|Apis mellifera Rh-like protein protein. Length = 471 Score = 23.4 bits (48), Expect = 2.3 Identities = 8/17 (47%), Positives = 15/17 (88%) Frame = +3 Query: 450 MGVLKIIIDTVIKYIGK 500 MG++++I+ TV KY+G+ Sbjct: 146 MGIVELIMFTVNKYVGE 162 >AY921573-1|AAX62923.1| 694|Apis mellifera D2-like dopamine receptor protein. Length = 694 Score = 23.0 bits (47), Expect = 3.0 Identities = 8/33 (24%), Positives = 20/33 (60%) Frame = +2 Query: 155 GRPSRCNAGYILDERIAK*RVHVTIIQIPITKT 253 G+PS+ N G + + + + V+++ +P+ +T Sbjct: 538 GQPSKRNGGETNKQELKRLKSTVSLLPLPLART 570 >AY569719-1|AAS86672.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 22.6 bits (46), Expect = 4.0 Identities = 8/18 (44%), Positives = 11/18 (61%) Frame = +2 Query: 422 KRRRGWRTQHGRFKDHHR 475 +RRR W Q R ++H R Sbjct: 37 RRRREWMIQQEREREHER 54 >AY569718-1|AAS86671.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 22.6 bits (46), Expect = 4.0 Identities = 8/18 (44%), Positives = 11/18 (61%) Frame = +2 Query: 422 KRRRGWRTQHGRFKDHHR 475 +RRR W Q R ++H R Sbjct: 37 RRRREWMIQQEREREHER 54 >AY569715-1|AAS86668.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 22.6 bits (46), Expect = 4.0 Identities = 8/18 (44%), Positives = 11/18 (61%) Frame = +2 Query: 422 KRRRGWRTQHGRFKDHHR 475 +RRR W Q R ++H R Sbjct: 37 RRRREWMIQQEREREHER 54 >AY569714-1|AAS86667.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 22.6 bits (46), Expect = 4.0 Identities = 8/18 (44%), Positives = 11/18 (61%) Frame = +2 Query: 422 KRRRGWRTQHGRFKDHHR 475 +RRR W Q R ++H R Sbjct: 37 RRRREWMIQQEREREHER 54 >AY569713-1|AAS86666.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 22.6 bits (46), Expect = 4.0 Identities = 8/18 (44%), Positives = 11/18 (61%) Frame = +2 Query: 422 KRRRGWRTQHGRFKDHHR 475 +RRR W Q R ++H R Sbjct: 37 RRRREWMIQQEREREHER 54 >AY569711-1|AAS86664.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 22.6 bits (46), Expect = 4.0 Identities = 8/18 (44%), Positives = 11/18 (61%) Frame = +2 Query: 422 KRRRGWRTQHGRFKDHHR 475 +RRR W Q R ++H R Sbjct: 37 RRRREWMIQQEREREHER 54 >AY569702-1|AAS86655.1| 400|Apis mellifera feminizer protein. Length = 400 Score = 22.6 bits (46), Expect = 4.0 Identities = 8/18 (44%), Positives = 11/18 (61%) Frame = +2 Query: 422 KRRRGWRTQHGRFKDHHR 475 +RRR W Q R ++H R Sbjct: 37 RRRREWMIQQEREREHER 54 >AY350616-1|AAQ57658.1| 401|Apis mellifera complementary sex determiner protein. Length = 401 Score = 22.6 bits (46), Expect = 4.0 Identities = 8/18 (44%), Positives = 11/18 (61%) Frame = +2 Query: 422 KRRRGWRTQHGRFKDHHR 475 +RRR W Q R ++H R Sbjct: 37 RRRREWMIQQEREREHER 54 >AB022908-1|BAA86909.1| 493|Apis mellifera amylase protein. Length = 493 Score = 22.6 bits (46), Expect = 4.0 Identities = 7/12 (58%), Positives = 8/12 (66%) Frame = +1 Query: 223 NNYSDPDNENEC 258 NNY+DP N C Sbjct: 159 NNYNDPSNVRNC 170 >DQ342041-1|ABC69933.1| 828|Apis mellifera STIP protein. Length = 828 Score = 22.2 bits (45), Expect = 5.3 Identities = 11/31 (35%), Positives = 15/31 (48%), Gaps = 4/31 (12%) Frame = +1 Query: 109 LDLCASVKLT----PFKPMRPPKPMQCWIHP 189 LD+ KLT + P+ P+ WIHP Sbjct: 515 LDMLVLPKLTLEVEEWNPLTDTVPIHTWIHP 545 >DQ435324-1|ABD92639.1| 152|Apis mellifera OBP3 protein. Length = 152 Score = 21.8 bits (44), Expect = 7.0 Identities = 9/31 (29%), Positives = 15/31 (48%) Frame = -3 Query: 260 QHSFSLSGSE*LLRGRVTLQFARRGCIQHCI 168 Q + +L + LL +RGCI+ C+ Sbjct: 30 QENLNLDDIDSLLEDESERMLRKRGCIEACL 60 >AB269871-1|BAF03050.1| 1923|Apis mellifera cell adhesion molecule AbsCAM-Ig7B protein. Length = 1923 Score = 21.8 bits (44), Expect = 7.0 Identities = 11/42 (26%), Positives = 18/42 (42%) Frame = +3 Query: 396 KPIRTEHFRSVDEAGEHNMGVLKIIIDTVIKYIGKLAETSTF 521 +PI + +RSVDE L ++ + KY + F Sbjct: 1152 EPILADMWRSVDEMEVRKTSALTTVLTGLRKYTNYTIQVLAF 1193 >AB257298-1|BAE93381.1| 1919|Apis mellifera Dscam family member AbsCAM-Ig7A protein. Length = 1919 Score = 21.8 bits (44), Expect = 7.0 Identities = 11/42 (26%), Positives = 18/42 (42%) Frame = +3 Query: 396 KPIRTEHFRSVDEAGEHNMGVLKIIIDTVIKYIGKLAETSTF 521 +PI + +RSVDE L ++ + KY + F Sbjct: 1148 EPILADMWRSVDEMEVRKTSALTTVLTGLRKYTNYTIQVLAF 1189 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 183,519 Number of Sequences: 438 Number of extensions: 3897 Number of successful extensions: 17 Number of sequences better than 10.0: 15 Number of HSP's better than 10.0 without gapping: 17 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 17 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 23266665 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -