BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV120041.Seq (827 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_33738| Best HMM Match : Pox_A32 (HMM E-Value=0.33) 30 2.0 SB_25063| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.6 >SB_33738| Best HMM Match : Pox_A32 (HMM E-Value=0.33) Length = 437 Score = 30.3 bits (65), Expect = 2.0 Identities = 15/41 (36%), Positives = 21/41 (51%) Frame = -3 Query: 576 RKNAIRRATHANKTCSGLWCLECSCSCVNAVYNALRAACET 454 ++NA+ A AN T GL L SC+ + + ACET Sbjct: 101 KENALNAAHGANHTRQGLATLRSSCTPTSRAFALQSTACET 141 >SB_25063| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1203 Score = 29.9 bits (64), Expect = 2.6 Identities = 15/52 (28%), Positives = 28/52 (53%), Gaps = 2/52 (3%) Frame = +3 Query: 153 DAYHD-DGWFICNSHLIKRFKMSKMVL-PIFDEDDNNSK*RSLGI*LEIKKE 302 DA D GW++ L+K+F+ S+M + +DD + + + L++ KE Sbjct: 186 DASSDFKGWYLLKKQLLKKFENSRMATKKLVSDDDGTPYRKKMKLSLKVNKE 237 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 26,366,131 Number of Sequences: 59808 Number of extensions: 538893 Number of successful extensions: 1466 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1369 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1463 length of database: 16,821,457 effective HSP length: 81 effective length of database: 11,977,009 effective search space used: 2323539746 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -