BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV120041.Seq (827 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At4g39370.2 68417.m05572 ubiquitin-specific protease 27, putativ... 30 2.2 At4g39370.1 68417.m05573 ubiquitin-specific protease 27, putativ... 30 2.2 At3g51440.1 68416.m05634 strictosidine synthase family protein s... 29 2.8 At2g32910.1 68415.m04035 expressed protein 29 2.8 At5g45220.1 68418.m05550 Toll-Interleukin-Resistance (TIR) domai... 28 6.6 At5g40100.1 68418.m04864 disease resistance protein (TIR-NBS-LRR... 28 6.6 >At4g39370.2 68417.m05572 ubiquitin-specific protease 27, putative (UBP27) similar to GI:11993494; ubiquitin specific protease 66 - Gallus gallus,PID:g3800764 Length = 361 Score = 29.9 bits (64), Expect = 2.2 Identities = 14/41 (34%), Positives = 25/41 (60%) Frame = +2 Query: 311 RILIPSATNYQEVFNLNSMMQAEQLIFHLIYNNEEAVNVIC 433 R ++ + T+Y + FNL S A + + HLI + +E + V+C Sbjct: 147 RKVMVTLTDYAKNFNLTSQQDAAEALLHLISSLQEEI-VVC 186 >At4g39370.1 68417.m05573 ubiquitin-specific protease 27, putative (UBP27) similar to GI:11993494; ubiquitin specific protease 66 - Gallus gallus,PID:g3800764 Length = 494 Score = 29.9 bits (64), Expect = 2.2 Identities = 14/41 (34%), Positives = 25/41 (60%) Frame = +2 Query: 311 RILIPSATNYQEVFNLNSMMQAEQLIFHLIYNNEEAVNVIC 433 R ++ + T+Y + FNL S A + + HLI + +E + V+C Sbjct: 147 RKVMVTLTDYAKNFNLTSQQDAAEALLHLISSLQEEI-VVC 186 >At3g51440.1 68416.m05634 strictosidine synthase family protein similar to hemomucin [Drosophila melanogaster][GI:1280434], strictosidine synthase [Rauvolfia serpentina][SP|P15324]; contains strictosidine synthase domain PF03088 Length = 371 Score = 29.5 bits (63), Expect = 2.8 Identities = 21/53 (39%), Positives = 27/53 (50%), Gaps = 3/53 (5%) Frame = +3 Query: 156 AYHDDGWFI---CNSHLIKRFKMSKMVLPIFDEDDNNSK*RSLGI*LEIKKEV 305 AYH+D FI C +KR K+++ V ED N+ R LGI I EV Sbjct: 74 AYHEDSGFIYTGCVDGWVKRVKVAESVNDSLVEDLVNTGGRPLGIAFGIHGEV 126 >At2g32910.1 68415.m04035 expressed protein Length = 691 Score = 29.5 bits (63), Expect = 2.8 Identities = 13/37 (35%), Positives = 21/37 (56%) Frame = +3 Query: 153 DAYHDDGWFICNSHLIKRFKMSKMVLPIFDEDDNNSK 263 D+Y D ++IC H ++R + MV P +DD S+ Sbjct: 610 DSYRRDPYYICERHALERPPRTYMVSPGRQDDDLYSR 646 >At5g45220.1 68418.m05550 Toll-Interleukin-Resistance (TIR) domain-containing protein domain signature TIR exists, suggestive of a disease resistance protein. Length = 546 Score = 28.3 bits (60), Expect = 6.6 Identities = 17/49 (34%), Positives = 29/49 (59%), Gaps = 2/49 (4%) Frame = +3 Query: 612 GDQLFNNYSGFLQNLIRRAVAPEYLQIDTEELRFRNSATCI--IDETGL 752 GDQL NN+ G+L + +RR+ + ID +E R + T I+++G+ Sbjct: 339 GDQLRNNFVGYLVDALRRSEINVF--IDNQEQRGEDLNTLFKRIEDSGI 385 >At5g40100.1 68418.m04864 disease resistance protein (TIR-NBS-LRR class), putative domain signature TIR-NBS-LRR exists, suggestive of a disease resistance protein. Length = 1017 Score = 28.3 bits (60), Expect = 6.6 Identities = 16/45 (35%), Positives = 24/45 (53%), Gaps = 1/45 (2%) Frame = +2 Query: 458 SQAARNALYTAFTQLQ-EHSRHHKPEHVLFACVARRIAFFRRDQR 589 S A+R + Y F + E +RH H+ A +R IA F+ D+R Sbjct: 4 SSASRASSYDVFLSFRGEDTRHSIVSHLYEALTSRGIATFKDDKR 48 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,964,700 Number of Sequences: 28952 Number of extensions: 363631 Number of successful extensions: 866 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 851 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 866 length of database: 12,070,560 effective HSP length: 80 effective length of database: 9,754,400 effective search space used: 1902108000 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -