BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV120040.Seq (757 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY578810-1|AAT07315.1| 897|Anopheles gambiae smurf protein. 24 4.4 AY753540-1|AAV28543.1| 3320|Anopheles gambiae SGS3 protein. 24 5.8 AY753539-1|AAV28542.1| 3318|Anopheles gambiae SGS2 protein. 24 5.8 >AY578810-1|AAT07315.1| 897|Anopheles gambiae smurf protein. Length = 897 Score = 24.2 bits (50), Expect = 4.4 Identities = 9/21 (42%), Positives = 13/21 (61%) Frame = +2 Query: 350 QYFKDEHYSVSCQNGSVLKSK 412 QY +D+HYS+ S LK + Sbjct: 556 QYSRDDHYSLQINPDSYLKQR 576 >AY753540-1|AAV28543.1| 3320|Anopheles gambiae SGS3 protein. Length = 3320 Score = 23.8 bits (49), Expect = 5.8 Identities = 13/45 (28%), Positives = 19/45 (42%) Frame = +2 Query: 224 SYTKRYAQEQHLRDRIKSKVDEQFDQLEREYSDKIDGFHDNIQYF 358 SY K + + HL + D QL Y ++ D F I +F Sbjct: 1819 SYVKTHHGDHHLTTYMYDTNDRLVLQLPPAYHEQADTFSRTIPFF 1863 >AY753539-1|AAV28542.1| 3318|Anopheles gambiae SGS2 protein. Length = 3318 Score = 23.8 bits (49), Expect = 5.8 Identities = 13/45 (28%), Positives = 19/45 (42%) Frame = +2 Query: 224 SYTKRYAQEQHLRDRIKSKVDEQFDQLEREYSDKIDGFHDNIQYF 358 SY K + + HL + D QL Y ++ D F I +F Sbjct: 1820 SYVKTHHGDHHLTTYMYDTNDRLVLQLPPAYHEQADTFSRTIPFF 1864 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 783,941 Number of Sequences: 2352 Number of extensions: 16689 Number of successful extensions: 21 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 19 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 21 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 78170964 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -