BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV120040.Seq (757 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g45310.1 68418.m05562 expressed protein 35 0.051 At5g07380.1 68418.m00845 hypothetical protein 31 1.1 At2g44400.1 68415.m05522 DC1 domain-containing protein similar ... 31 1.1 At1g09790.1 68414.m01098 phytochelatin synthetase-related contai... 29 2.5 At5g45790.1 68418.m05631 expressed protein ; expression support... 29 3.3 At5g41940.1 68418.m05106 RabGAP/TBC domain-containing protein si... 29 4.4 At4g24530.1 68417.m03516 expressed protein contains Pfam PF03138... 29 4.4 At2g25320.1 68415.m03029 meprin and TRAF homology domain-contain... 29 4.4 At1g24460.1 68414.m03081 myosin-related contains TIGRFAM TIGR016... 29 4.4 At4g21130.1 68417.m03055 transducin family protein / WD-40 repea... 28 5.8 At3g49350.1 68416.m05395 RabGAP/TBC domain-containing protein si... 28 5.8 At2g47570.1 68415.m05936 60S ribosomal protein L18 (RPL18A) 28 5.8 At5g15630.1 68418.m01829 phytochelatin synthetase family protein... 28 7.7 At2g22630.1 68415.m02682 MADS-box protein (AGL17) nearly identic... 28 7.7 >At5g45310.1 68418.m05562 expressed protein Length = 352 Score = 35.1 bits (77), Expect = 0.051 Identities = 22/76 (28%), Positives = 42/76 (55%), Gaps = 5/76 (6%) Frame = +2 Query: 248 EQHLRDRIKSK--VDEQFDQLEREYSD---KIDGFHDNIQYFKDEHYSVSCQNGSVLKSK 412 E++LR+ IK +++ D+LE E+ + KI+ +Q K+E+ + NG +SK Sbjct: 111 EKNLREAIKEYRIMEQDLDELEDEHDEAISKIEKLEAELQELKEENLQLMEVNGKDYRSK 170 Query: 413 FAKILKSHDYTDKKSI 460 K+ S + ++ +SI Sbjct: 171 KGKVKPSEEPSEIRSI 186 >At5g07380.1 68418.m00845 hypothetical protein Length = 595 Score = 30.7 bits (66), Expect = 1.1 Identities = 14/42 (33%), Positives = 21/42 (50%) Frame = +1 Query: 517 VAVCVLKPGFENGSNQVLSFEYNPIGNKVIVPFAHEINDTGL 642 + +C + +G++Q L F Y P GN + F H IN L Sbjct: 45 IGLCYILKDRISGNDQQLKFAYTPTGNFCLRDFHHAINSLPL 86 >At2g44400.1 68415.m05522 DC1 domain-containing protein similar to GP|2435515|AF024504 Length = 146 Score = 30.7 bits (66), Expect = 1.1 Identities = 13/30 (43%), Positives = 20/30 (66%) Frame = -3 Query: 566 TWLLPFSNPGFNTHTAT*QCCVCRPIGANS 477 T+ +P PG + ++ QCCVCR +G+NS Sbjct: 103 TFSMPPGGPG-SAAASSFQCCVCRGLGSNS 131 >At1g09790.1 68414.m01098 phytochelatin synthetase-related contains Pfam profile PF04833: Phytochelatin synthetase-like conserved region Length = 454 Score = 29.5 bits (63), Expect = 2.5 Identities = 20/55 (36%), Positives = 30/55 (54%) Frame = +1 Query: 529 VLKPGFENGSNQVLSFEYNPIGNKVIVPFAHEINDTGLYEYDVLAYVDSVEFDGK 693 VL P ++ QV SF Y K + P+ + INDTG++ + V Y D + +GK Sbjct: 328 VLHPNLKS-VQQVFSFNY-----KSLTPYQNSINDTGMF-WGVQFYNDVLLQEGK 375 >At5g45790.1 68418.m05631 expressed protein ; expression supported by MPSS Length = 423 Score = 29.1 bits (62), Expect = 3.3 Identities = 13/37 (35%), Positives = 24/37 (64%), Gaps = 2/37 (5%) Frame = +3 Query: 66 CKMCVIFPVEIDVSQTVIRDCHVD--EQTRELVYINK 170 CK+ F V ID + V+R+C VD ++ ++L+ ++K Sbjct: 129 CKITEKFKVLIDEEENVVRECEVDAVKRVKKLLLLSK 165 >At5g41940.1 68418.m05106 RabGAP/TBC domain-containing protein similar to GTPase activating protein [Yarrowia lipolytica] GI:2370595; contains Pfam profile PF00566: TBC domain Length = 549 Score = 28.7 bits (61), Expect = 4.4 Identities = 17/49 (34%), Positives = 28/49 (57%), Gaps = 1/49 (2%) Frame = -2 Query: 657 DVVLVKSRVVNFVSKRHNNFVTNRVVLKR*-HLVAAVLKSRLQHAYRHV 514 D VL V F+SK +NF + V ++R +V+ ++K + H YRH+ Sbjct: 380 DDVLAFWCFVGFMSKARHNFRLDEVGIRRQLSMVSKIIKFKDIHLYRHL 428 >At4g24530.1 68417.m03516 expressed protein contains Pfam PF03138: Plant protein family. The function of this family of plant proteins is unknown; previously annotated as 'PsRT17-1 like protein' based on similarity to PsRT17-1 (GP:1778376) [Pisum sativum] which was based upon similarity to axi 1 protein (GB:X80301) (GI:559920) from [Nicotiana tabacum], which, due to scienitific fraud was retracted. Retraction in: Schell J. EMBO J 1999 May 17;18(10):2908. PMID:10400497. Length = 519 Score = 28.7 bits (61), Expect = 4.4 Identities = 18/43 (41%), Positives = 20/43 (46%) Frame = -3 Query: 407 FSTRCHFGNLPNSVHL*NTGCYREIHQFYRCIRVLVDQIVHRL 279 FS R F NLP S+ E F IR L D +VHRL Sbjct: 226 FSHRLAFDNLPESIQRLRCKVNFEALNFVPHIRELGDALVHRL 268 >At2g25320.1 68415.m03029 meprin and TRAF homology domain-containing protein / MATH domain-containing protein weak similarity to ubiquitin-specific protease 12 [Arabidopsis thaliana] GI:11993471; contains Pfam profile PF00917: MATH domain Length = 1663 Score = 28.7 bits (61), Expect = 4.4 Identities = 11/40 (27%), Positives = 23/40 (57%) Frame = +2 Query: 224 SYTKRYAQEQHLRDRIKSKVDEQFDQLEREYSDKIDGFHD 343 S T++ ++ + R+KS++ + D+ RE D ++ F D Sbjct: 1376 SITQKLSESEAANTRLKSEMKAEADRFSREKKDLVEQFRD 1415 >At1g24460.1 68414.m03081 myosin-related contains TIGRFAM TIGR01612: reticulocyte binding protein; similar to Myosin heavy chain, non-muscle (Zipper protein) (Myosin II) (SP:Q99323) {Drosophila melanogaster} similar to EST gb|T76116 Length = 1730 Score = 28.7 bits (61), Expect = 4.4 Identities = 12/38 (31%), Positives = 19/38 (50%) Frame = +2 Query: 248 EQHLRDRIKSKVDEQFDQLEREYSDKIDGFHDNIQYFK 361 E H I VD FD++E++ D D + N + F+ Sbjct: 617 EDHTSSDINLLVDRSFDKIEKQIRDSSDSSYGNEEIFE 654 >At4g21130.1 68417.m03055 transducin family protein / WD-40 repeat family protein contains 6 WD-40 repeats (PF00400); some similarity to a group of proteins with homology to mammalian apoptosis regulators identified in zebrafish (PUBMED:10917738)Apaf-1(gi:7677507) Length = 537 Score = 28.3 bits (60), Expect = 5.8 Identities = 15/33 (45%), Positives = 19/33 (57%), Gaps = 3/33 (9%) Frame = +3 Query: 123 DCHV---DEQTRELVYINKIMNTQLTKPVLMMF 212 DCHV D +TRE V +NK+ N Q+ V F Sbjct: 227 DCHVHLWDIRTREHVQVNKLKNNQVKDSVHCAF 259 >At3g49350.1 68416.m05395 RabGAP/TBC domain-containing protein similar to GTPase activating protein [Yarrowia lipolytica] GI:2370595; contains Pfam profile PF00566: TBC domain Length = 554 Score = 28.3 bits (60), Expect = 5.8 Identities = 14/43 (32%), Positives = 26/43 (60%), Gaps = 1/43 (2%) Frame = -2 Query: 630 VNFVSKRHNNFVTNRVVLKR*-HLVAAVLKSRLQHAYRHVAVL 505 V F+ K +NF + V ++R ++V+ ++KS+ YRH+ L Sbjct: 389 VGFMKKARHNFRLDEVGIRRQLNIVSKIIKSKDSQLYRHLEKL 431 >At2g47570.1 68415.m05936 60S ribosomal protein L18 (RPL18A) Length = 135 Score = 28.3 bits (60), Expect = 5.8 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +3 Query: 483 CPNWSTNTTLLRG 521 CP WS NT LLRG Sbjct: 76 CPTWSENTVLLRG 88 >At5g15630.1 68418.m01829 phytochelatin synthetase family protein / COBRA cell expansion protein COBL4 similar to phytochelatin synthetase [Hordeum vulgare subsp. vulgare] GI:29570314; identified in Roudier, et al, Plant Phys. (2002) 130:538-548 (PMID:12376623); contains Pfam profile PF04833: Phytochelatin synthetase-like conserved region Length = 431 Score = 27.9 bits (59), Expect = 7.7 Identities = 20/67 (29%), Positives = 29/67 (43%) Frame = +1 Query: 472 KILFAPIGRQTQHCYVAVCVLKPGFENGSNQVLSFEYNPIGNKVIVPFAHEINDTGLYEY 651 KI + H + + P N + QV SF+Y P+ P+ INDTG++ Y Sbjct: 295 KIAITNFNYRMNHTLWTLAIQHPNLNNVT-QVFSFDYKPVS-----PYG-SINDTGMF-Y 346 Query: 652 DVLAYVD 672 Y D Sbjct: 347 GTKFYND 353 >At2g22630.1 68415.m02682 MADS-box protein (AGL17) nearly identical to MADS-box protein AGL17 [Arabidopsis thaliana] GI:862648 Length = 227 Score = 27.9 bits (59), Expect = 7.7 Identities = 18/61 (29%), Positives = 27/61 (44%) Frame = -3 Query: 227 RTRNVKHHENGFCQLRVHNLVNVHQLSGLFVHMTISNNRLGHVDFYRKNYTHFAMVKLKC 48 R RN+ HHEN +V + + + T + N LGH + Y A V+L+ Sbjct: 154 RKRNLVHHENLELSRKVQRIHQENVELYKKAYGTSNTNGLGHHELVDAVYESHAQVRLQL 213 Query: 47 S 45 S Sbjct: 214 S 214 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,443,356 Number of Sequences: 28952 Number of extensions: 316986 Number of successful extensions: 943 Number of sequences better than 10.0: 14 Number of HSP's better than 10.0 without gapping: 920 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 943 length of database: 12,070,560 effective HSP length: 79 effective length of database: 9,783,352 effective search space used: 1682736544 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -