BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV120038.Seq (762 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z82260-3|CAB05131.1| 346|Caenorhabditis elegans Hypothetical pr... 29 4.8 U39645-9|AAM51511.1| 297|Caenorhabditis elegans Hypothetical pr... 28 8.3 U39645-8|AAA80361.1| 414|Caenorhabditis elegans Hypothetical pr... 28 8.3 >Z82260-3|CAB05131.1| 346|Caenorhabditis elegans Hypothetical protein C32H11.4 protein. Length = 346 Score = 28.7 bits (61), Expect = 4.8 Identities = 11/37 (29%), Positives = 20/37 (54%) Frame = +3 Query: 45 VGMAPRQMRVNRCIFASIVSFDACITYKSPCSPDAYH 155 +GM P + + + +FA+ S D + SP P+ Y+ Sbjct: 146 IGMQPHVLNITQDLFAADFSSDKVALFVSPADPNDYY 182 >U39645-9|AAM51511.1| 297|Caenorhabditis elegans Hypothetical protein C14F11.1b protein. Length = 297 Score = 27.9 bits (59), Expect = 8.3 Identities = 9/29 (31%), Positives = 19/29 (65%) Frame = +3 Query: 669 EYLQIDTEELRFRNSATCIIDETGLVASV 755 ++ +D ++ R+ + +TC DETG +A + Sbjct: 154 KFAGVDVKQYRYYDKSTCGFDETGALADI 182 >U39645-8|AAA80361.1| 414|Caenorhabditis elegans Hypothetical protein C14F11.1a protein. Length = 414 Score = 27.9 bits (59), Expect = 8.3 Identities = 9/29 (31%), Positives = 19/29 (65%) Frame = +3 Query: 669 EYLQIDTEELRFRNSATCIIDETGLVASV 755 ++ +D ++ R+ + +TC DETG +A + Sbjct: 154 KFAGVDVKQYRYYDKSTCGFDETGALADI 182 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,942,484 Number of Sequences: 27780 Number of extensions: 372437 Number of successful extensions: 996 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 962 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 996 length of database: 12,740,198 effective HSP length: 80 effective length of database: 10,517,798 effective search space used: 1819579054 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -