BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV120035.Seq (749 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ439060-11|CAD27762.1| 1881|Anopheles gambiae putative cell-adh... 27 0.82 AY183375-1|AAO24765.1| 679|Anopheles gambiae NADPH cytochrome P... 25 3.3 AF364130-1|AAL35506.1| 417|Anopheles gambiae putative odorant r... 24 4.4 >AJ439060-11|CAD27762.1| 1881|Anopheles gambiae putative cell-adhesion protein protein. Length = 1881 Score = 26.6 bits (56), Expect = 0.82 Identities = 15/53 (28%), Positives = 24/53 (45%), Gaps = 3/53 (5%) Frame = +3 Query: 3 DIGGDTIVNNQTTMTQ---INFNASYTSAPTPSRASFDNGYSEFCDKQQPNDY 152 D G+ +V N+ + +NF+ TP RASF + + D+ N Y Sbjct: 1007 DETGEIVVRNRIDHEEYSWLNFSVRAADTGTPPRASFVEVFVQVLDENDNNPY 1059 >AY183375-1|AAO24765.1| 679|Anopheles gambiae NADPH cytochrome P450 reductase protein. Length = 679 Score = 24.6 bits (51), Expect = 3.3 Identities = 6/23 (26%), Positives = 16/23 (69%) Frame = +3 Query: 117 SEFCDKQQPNDYLNYYNNPTPDG 185 +E+C +++ ++L + ++ PDG Sbjct: 393 AEYCGEEKDKEFLRFISSTAPDG 415 >AF364130-1|AAL35506.1| 417|Anopheles gambiae putative odorant receptor Or1 protein. Length = 417 Score = 24.2 bits (50), Expect = 4.4 Identities = 7/16 (43%), Positives = 11/16 (68%) Frame = -3 Query: 189 RLHPAWDCYNNSNSRW 142 +L+P WD Y+ +S W Sbjct: 5 KLNPRWDAYDRRDSFW 20 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 756,423 Number of Sequences: 2352 Number of extensions: 16726 Number of successful extensions: 27 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 26 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 27 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 77339358 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -