BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV120035.Seq (749 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY703685-1|AAU12681.1| 200|Apis mellifera abdominal-A protein. 24 1.3 DQ667188-1|ABG75740.1| 383|Apis mellifera histamine-gated chlor... 22 7.1 AY569705-1|AAS86658.1| 419|Apis mellifera complementary sex det... 21 9.3 >AY703685-1|AAU12681.1| 200|Apis mellifera abdominal-A protein. Length = 200 Score = 24.2 bits (50), Expect = 1.3 Identities = 13/66 (19%), Positives = 27/66 (40%) Frame = +3 Query: 27 NNQTTMTQINFNASYTSAPTPSRASFDNGYSEFCDKQQPNDYLNYYNNPTPDGADTVVSD 206 ++Q + N +P+ AS ++ S +Y +N+P+P G+ S Sbjct: 14 HHQQLFSSANPGTIQACTTSPATASLESSLSAAAVAAAAVNYAQQHNSPSPTGSSPQHSG 73 Query: 207 SETAAA 224 S + + Sbjct: 74 SSASTS 79 >DQ667188-1|ABG75740.1| 383|Apis mellifera histamine-gated chloride channel protein. Length = 383 Score = 21.8 bits (44), Expect = 7.1 Identities = 8/24 (33%), Positives = 15/24 (62%) Frame = +3 Query: 522 KKSTIQSCATLEQTINHNTNICTV 593 K + + SCA ++ H+T IC++ Sbjct: 125 KLTLVLSCAMKFESYPHDTQICSM 148 >AY569705-1|AAS86658.1| 419|Apis mellifera complementary sex determiner protein. Length = 419 Score = 21.4 bits (43), Expect = 9.3 Identities = 5/27 (18%), Positives = 17/27 (62%) Frame = +3 Query: 663 NDYNSNRFSDHMSETGYYMFVVKKSEV 743 N+YN+N ++++ + Y +++ ++ Sbjct: 331 NNYNNNNYNNYNKKLYYKNYIINIEQI 357 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 202,053 Number of Sequences: 438 Number of extensions: 4514 Number of successful extensions: 7 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 23510295 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -