BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV120031.Seq (726 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY062199-1|AAL58560.1| 151|Anopheles gambiae cytochrome P450 CY... 23 7.3 DQ986315-1|ABK59975.1| 504|Anopheles gambiae catalase protein. 23 9.6 DQ980210-1|ABL09378.1| 504|Anopheles gambiae catalase protein. 23 9.6 DQ980209-1|ABL09377.1| 504|Anopheles gambiae catalase protein. 23 9.6 DQ980208-1|ABL09376.1| 504|Anopheles gambiae catalase protein. 23 9.6 DQ980207-1|ABL09375.1| 504|Anopheles gambiae catalase protein. 23 9.6 DQ980206-1|ABL09374.1| 504|Anopheles gambiae catalase protein. 23 9.6 DQ980205-1|ABL09373.1| 504|Anopheles gambiae catalase protein. 23 9.6 DQ980204-1|ABL09372.1| 504|Anopheles gambiae catalase protein. 23 9.6 DQ980203-1|ABL09371.1| 504|Anopheles gambiae catalase protein. 23 9.6 DQ980202-1|ABL09370.1| 504|Anopheles gambiae catalase protein. 23 9.6 DQ980201-1|ABL09369.1| 504|Anopheles gambiae catalase protein. 23 9.6 DQ980200-1|ABL09368.1| 504|Anopheles gambiae catalase protein. 23 9.6 DQ980199-1|ABL09367.1| 504|Anopheles gambiae catalase protein. 23 9.6 AY505416-1|AAR90327.1| 485|Anopheles gambiae catalase 1 protein. 23 9.6 AB090813-2|BAC57902.1| 1099|Anopheles gambiae reverse transcript... 23 9.6 >AY062199-1|AAL58560.1| 151|Anopheles gambiae cytochrome P450 CYP4H19 protein. Length = 151 Score = 23.4 bits (48), Expect = 7.3 Identities = 11/36 (30%), Positives = 16/36 (44%) Frame = +3 Query: 573 HAAVENDEGAILQRIFHTTVRHVPRSLYERQRFPHL 680 H ++ LQ + RHVP + Q FP+L Sbjct: 27 HPEIQEKLHQELQDVLGVDYRHVPLTYNTLQNFPYL 62 >DQ986315-1|ABK59975.1| 504|Anopheles gambiae catalase protein. Length = 504 Score = 23.0 bits (47), Expect = 9.6 Identities = 9/16 (56%), Positives = 10/16 (62%) Frame = -3 Query: 511 SHGVPYGGKRVSKTLG 464 SHG P G K S+T G Sbjct: 26 SHGAPVGTKTASETAG 41 >DQ980210-1|ABL09378.1| 504|Anopheles gambiae catalase protein. Length = 504 Score = 23.0 bits (47), Expect = 9.6 Identities = 9/16 (56%), Positives = 10/16 (62%) Frame = -3 Query: 511 SHGVPYGGKRVSKTLG 464 SHG P G K S+T G Sbjct: 26 SHGAPVGTKTASETAG 41 >DQ980209-1|ABL09377.1| 504|Anopheles gambiae catalase protein. Length = 504 Score = 23.0 bits (47), Expect = 9.6 Identities = 9/16 (56%), Positives = 10/16 (62%) Frame = -3 Query: 511 SHGVPYGGKRVSKTLG 464 SHG P G K S+T G Sbjct: 26 SHGAPVGTKTASETAG 41 >DQ980208-1|ABL09376.1| 504|Anopheles gambiae catalase protein. Length = 504 Score = 23.0 bits (47), Expect = 9.6 Identities = 9/16 (56%), Positives = 10/16 (62%) Frame = -3 Query: 511 SHGVPYGGKRVSKTLG 464 SHG P G K S+T G Sbjct: 26 SHGAPVGTKTASETAG 41 >DQ980207-1|ABL09375.1| 504|Anopheles gambiae catalase protein. Length = 504 Score = 23.0 bits (47), Expect = 9.6 Identities = 9/16 (56%), Positives = 10/16 (62%) Frame = -3 Query: 511 SHGVPYGGKRVSKTLG 464 SHG P G K S+T G Sbjct: 26 SHGAPVGTKTASETAG 41 >DQ980206-1|ABL09374.1| 504|Anopheles gambiae catalase protein. Length = 504 Score = 23.0 bits (47), Expect = 9.6 Identities = 9/16 (56%), Positives = 10/16 (62%) Frame = -3 Query: 511 SHGVPYGGKRVSKTLG 464 SHG P G K S+T G Sbjct: 26 SHGAPVGTKTASETAG 41 >DQ980205-1|ABL09373.1| 504|Anopheles gambiae catalase protein. Length = 504 Score = 23.0 bits (47), Expect = 9.6 Identities = 9/16 (56%), Positives = 10/16 (62%) Frame = -3 Query: 511 SHGVPYGGKRVSKTLG 464 SHG P G K S+T G Sbjct: 26 SHGAPVGTKTASETAG 41 >DQ980204-1|ABL09372.1| 504|Anopheles gambiae catalase protein. Length = 504 Score = 23.0 bits (47), Expect = 9.6 Identities = 9/16 (56%), Positives = 10/16 (62%) Frame = -3 Query: 511 SHGVPYGGKRVSKTLG 464 SHG P G K S+T G Sbjct: 26 SHGAPVGTKTASETAG 41 >DQ980203-1|ABL09371.1| 504|Anopheles gambiae catalase protein. Length = 504 Score = 23.0 bits (47), Expect = 9.6 Identities = 9/16 (56%), Positives = 10/16 (62%) Frame = -3 Query: 511 SHGVPYGGKRVSKTLG 464 SHG P G K S+T G Sbjct: 26 SHGAPVGTKTASETAG 41 >DQ980202-1|ABL09370.1| 504|Anopheles gambiae catalase protein. Length = 504 Score = 23.0 bits (47), Expect = 9.6 Identities = 9/16 (56%), Positives = 10/16 (62%) Frame = -3 Query: 511 SHGVPYGGKRVSKTLG 464 SHG P G K S+T G Sbjct: 26 SHGAPVGTKTASETAG 41 >DQ980201-1|ABL09369.1| 504|Anopheles gambiae catalase protein. Length = 504 Score = 23.0 bits (47), Expect = 9.6 Identities = 9/16 (56%), Positives = 10/16 (62%) Frame = -3 Query: 511 SHGVPYGGKRVSKTLG 464 SHG P G K S+T G Sbjct: 26 SHGAPVGTKTASETAG 41 >DQ980200-1|ABL09368.1| 504|Anopheles gambiae catalase protein. Length = 504 Score = 23.0 bits (47), Expect = 9.6 Identities = 9/16 (56%), Positives = 10/16 (62%) Frame = -3 Query: 511 SHGVPYGGKRVSKTLG 464 SHG P G K S+T G Sbjct: 26 SHGAPVGTKTASETAG 41 >DQ980199-1|ABL09367.1| 504|Anopheles gambiae catalase protein. Length = 504 Score = 23.0 bits (47), Expect = 9.6 Identities = 9/16 (56%), Positives = 10/16 (62%) Frame = -3 Query: 511 SHGVPYGGKRVSKTLG 464 SHG P G K S+T G Sbjct: 26 SHGAPVGTKTASETAG 41 >AY505416-1|AAR90327.1| 485|Anopheles gambiae catalase 1 protein. Length = 485 Score = 23.0 bits (47), Expect = 9.6 Identities = 9/16 (56%), Positives = 10/16 (62%) Frame = -3 Query: 511 SHGVPYGGKRVSKTLG 464 SHG P G K S+T G Sbjct: 10 SHGAPVGTKTASETAG 25 >AB090813-2|BAC57902.1| 1099|Anopheles gambiae reverse transcriptase protein. Length = 1099 Score = 23.0 bits (47), Expect = 9.6 Identities = 13/40 (32%), Positives = 22/40 (55%) Frame = +2 Query: 251 SSKSAHLTKLLSSQATYLYHFACLMKYKDIQKYEVQQLIE 370 S A KLL+S + + +A + K++QK E +L+E Sbjct: 769 SEPRASKAKLLASVSESVMRYAAPVWSKELQKREPGRLLE 808 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 776,420 Number of Sequences: 2352 Number of extensions: 15746 Number of successful extensions: 44 Number of sequences better than 10.0: 16 Number of HSP's better than 10.0 without gapping: 43 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 44 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 74012934 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -