SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= NV120028.Seq
         (721 letters)

Database: tribolium 
           336 sequences; 122,585 total letters

Searching.......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

EF592178-1|ABQ95974.1|  532|Tribolium castaneum tyrosine hydroxy...    28   0.088
AM292340-1|CAL23152.1|  355|Tribolium castaneum gustatory recept...    26   0.27 
AY884062-1|AAX84203.1|  712|Tribolium castaneum laccase 2B protein.    23   1.9  
AY884061-1|AAX84202.1|  717|Tribolium castaneum laccase 2A protein.    23   1.9  

>EF592178-1|ABQ95974.1|  532|Tribolium castaneum tyrosine
           hydroxylase protein.
          Length = 532

 Score = 27.9 bits (59), Expect = 0.088
 Identities = 14/46 (30%), Positives = 23/46 (50%)
 Frame = +3

Query: 561 SEKFMVTHETFKNDVGNRFEQFELRLNELDAKLNMLQSAEKLKTAI 698
           +E F    + F+  V      FE+R N    ++ +L S EKL+T +
Sbjct: 464 AESFDDMKDKFRRWVSAMSRPFEVRFNPHTGRVEVLDSVEKLETLV 509


>AM292340-1|CAL23152.1|  355|Tribolium castaneum gustatory receptor
           candidate 19 protein.
          Length = 355

 Score = 26.2 bits (55), Expect = 0.27
 Identities = 11/33 (33%), Positives = 17/33 (51%)
 Frame = -2

Query: 270 IYYIVDFAFVSLCTYLYLKLCVLHLNESHLTMC 172
           IYY   +AF+    +L L +C+ +    HL  C
Sbjct: 238 IYYFY-YAFILFTVHLLLLVCIYYFYYMHLLFC 269


>AY884062-1|AAX84203.1|  712|Tribolium castaneum laccase 2B protein.
          Length = 712

 Score = 23.4 bits (48), Expect = 1.9
 Identities = 7/11 (63%), Positives = 9/11 (81%)
 Frame = +2

Query: 374 PNAISTRWAHC 406
           PNA +T W+HC
Sbjct: 142 PNATNTVWSHC 152


>AY884061-1|AAX84202.1|  717|Tribolium castaneum laccase 2A protein.
          Length = 717

 Score = 23.4 bits (48), Expect = 1.9
 Identities = 7/11 (63%), Positives = 9/11 (81%)
 Frame = +2

Query: 374 PNAISTRWAHC 406
           PNA +T W+HC
Sbjct: 142 PNATNTVWSHC 152


  Database: tribolium
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 122,585
  Number of sequences in database:  336
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 145,485
Number of Sequences: 336
Number of extensions: 2905
Number of successful extensions: 10
Number of sequences better than 10.0: 4
Number of HSP's better than 10.0 without gapping: 10
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 10
length of database: 122,585
effective HSP length: 55
effective length of database: 104,105
effective search space used: 19155320
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2023 -