BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV120028.Seq (721 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AF069739-1|AAC63272.2| 690|Apis mellifera translation initiatio... 23 2.2 DQ435324-1|ABD92639.1| 152|Apis mellifera OBP3 protein. 22 5.1 AY242387-1|AAO72539.2| 693|Apis mellifera prophenoloxidase prot... 22 5.1 Z26319-1|CAA81228.1| 464|Apis mellifera royal jelly protein RJP... 21 8.9 AY937243-1|AAX33677.1| 1370|Apis mellifera Toll-like receptor pr... 21 8.9 >AF069739-1|AAC63272.2| 690|Apis mellifera translation initiation factor 2 protein. Length = 690 Score = 23.4 bits (48), Expect = 2.2 Identities = 15/51 (29%), Positives = 23/51 (45%) Frame = +1 Query: 331 QVYHLNEIIFHKQKSKRDLNSLGALFATKQGLLKILMRLNFDNKSNALLHL 483 Q YH+ + F KQK ++ L + L LM F NKS ++ + Sbjct: 9 QHYHITPV-FTKQKKVKEDTELNLQTIFNEDKLDNLMDKQFKNKSLPVIEI 58 >DQ435324-1|ABD92639.1| 152|Apis mellifera OBP3 protein. Length = 152 Score = 22.2 bits (45), Expect = 5.1 Identities = 9/32 (28%), Positives = 18/32 (56%) Frame = +3 Query: 621 QFELRLNELDAKLNMLQSAEKLKTAIVTESKN 716 +F++ LN+ D +++ S K+ V +KN Sbjct: 76 KFDVYLNDTDMDMDLKDSIRKIIRQCVDNAKN 107 >AY242387-1|AAO72539.2| 693|Apis mellifera prophenoloxidase protein. Length = 693 Score = 22.2 bits (45), Expect = 5.1 Identities = 12/45 (26%), Positives = 21/45 (46%) Frame = +3 Query: 510 RDKIESVLKHVKKLNTNSEKFMVTHETFKNDVGNRFEQFELRLNE 644 RD+I + +NT E+ +T + + +GN E L N+ Sbjct: 314 RDRIYEAIHTGSVINTRGERIQLTEKNGIDVLGNIMEASILSPNQ 358 >Z26319-1|CAA81228.1| 464|Apis mellifera royal jelly protein RJP57-2 protein. Length = 464 Score = 21.4 bits (43), Expect = 8.9 Identities = 12/42 (28%), Positives = 17/42 (40%) Frame = +2 Query: 122 FDPDDYKKYHINVQQ*SHIVKWDSFKCNTHSFKYRYVHNDTN 247 FD D Y+ N Q H K D+ N H+ + + N Sbjct: 417 FDNQDNNHYNHNHNQARHSSKSDNQNNNQHNDQAHHSSKSNN 458 >AY937243-1|AAX33677.1| 1370|Apis mellifera Toll-like receptor protein. Length = 1370 Score = 21.4 bits (43), Expect = 8.9 Identities = 10/40 (25%), Positives = 19/40 (47%) Frame = +3 Query: 567 KFMVTHETFKNDVGNRFEQFELRLNELDAKLNMLQSAEKL 686 K++ H F +GN ++ + ++ LDA N + L Sbjct: 574 KWLDIHGNFIESLGNYYKIRDSKVKTLDASHNRITELSPL 613 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 166,305 Number of Sequences: 438 Number of extensions: 3355 Number of successful extensions: 9 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 9 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 9 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 22292145 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -