BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV120021.Seq (683 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY321476-2|AAQ23387.1| 257|Tribolium castaneum Ase protein. 24 1.0 AF442747-1|AAL40947.1| 669|Tribolium castaneum ABC transmembran... 23 2.3 AF422804-1|AAL56571.1| 669|Tribolium castaneum ABC transmembran... 23 2.3 AY293621-1|AAP46162.1| 392|Tribolium castaneum glass protein pr... 22 4.1 AF263515-1|AAF74207.1| 126|Tribolium castaneum cytochrome P450 ... 22 4.1 AJ845189-1|CAH60166.1| 515|Tribolium castaneum putative esteras... 21 7.1 DQ490059-1|ABF22614.1| 947|Tribolium castaneum short gastrulati... 21 9.4 >AY321476-2|AAQ23387.1| 257|Tribolium castaneum Ase protein. Length = 257 Score = 24.2 bits (50), Expect = 1.0 Identities = 16/53 (30%), Positives = 27/53 (50%) Frame = +1 Query: 364 RVVFLRLEAPNVLAIRTLQLSFSKFTKASVSNSRLSILTIDGLSTEHNTPPRF 522 +V LR+ + ++ L L+ + T +S ++S S T D LST PP + Sbjct: 100 KVETLRMAVEYIRSLEDL-LALDESTVSSSTSSIPSPSTTDDLSTNPTPPPHY 151 >AF442747-1|AAL40947.1| 669|Tribolium castaneum ABC transmembrane transporter protein. Length = 669 Score = 23.0 bits (47), Expect = 2.3 Identities = 13/39 (33%), Positives = 24/39 (61%) Frame = +1 Query: 145 AHCRSQFVGKKRMVR*RLAIFKHPVIFKNIIMQIGMLTI 261 A C +QF K + R LA+FK P++ K ++Q ++++ Sbjct: 391 ASCWAQF--KAVLWRSILAVFKEPLLIKVRLLQTLIISL 427 >AF422804-1|AAL56571.1| 669|Tribolium castaneum ABC transmembrane transporter white protein. Length = 669 Score = 23.0 bits (47), Expect = 2.3 Identities = 13/39 (33%), Positives = 24/39 (61%) Frame = +1 Query: 145 AHCRSQFVGKKRMVR*RLAIFKHPVIFKNIIMQIGMLTI 261 A C +QF K + R LA+FK P++ K ++Q ++++ Sbjct: 391 ASCWAQF--KAVLWRSILAVFKEPLLIKVRLLQTLIISL 427 >AY293621-1|AAP46162.1| 392|Tribolium castaneum glass protein protein. Length = 392 Score = 22.2 bits (45), Expect = 4.1 Identities = 8/25 (32%), Positives = 12/25 (48%) Frame = +2 Query: 509 HPLVFCKQNGFSGNACVISFSDHKL 583 HP V G+SG+ C F+ + Sbjct: 119 HPQVLLSPGGYSGSLCDQGFAQQPM 143 >AF263515-1|AAF74207.1| 126|Tribolium castaneum cytochrome P450 monooxygenase protein. Length = 126 Score = 22.2 bits (45), Expect = 4.1 Identities = 7/10 (70%), Positives = 9/10 (90%) Frame = -1 Query: 179 RFLPTNCDRQ 150 RFLP NCD++ Sbjct: 111 RFLPENCDKR 120 >AJ845189-1|CAH60166.1| 515|Tribolium castaneum putative esterase protein. Length = 515 Score = 21.4 bits (43), Expect = 7.1 Identities = 9/31 (29%), Positives = 14/31 (45%) Frame = -2 Query: 613 PLVTNFTNKMEFVVTETNDTSIPGEPILFTE 521 P++ +T + +V T PG P F E Sbjct: 300 PMIFGYTTREGMIVEMMRKTETPGMPNDFEE 330 >DQ490059-1|ABF22614.1| 947|Tribolium castaneum short gastrulation protein. Length = 947 Score = 21.0 bits (42), Expect = 9.4 Identities = 6/19 (31%), Positives = 11/19 (57%) Frame = +2 Query: 323 YRNLVVYLTRNHRCASCFC 379 YR + + ++ C +CFC Sbjct: 680 YRQEAQWTSSDNPCTTCFC 698 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 139,092 Number of Sequences: 336 Number of extensions: 2786 Number of successful extensions: 7 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 17906060 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -