BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV120016.Seq (678 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF499232-2|AAP29639.1| 1183|Homo sapiens pol protein protein. 43 9e-04 >AF499232-2|AAP29639.1| 1183|Homo sapiens pol protein protein. Length = 1183 Score = 43.2 bits (97), Expect = 9e-04 Identities = 24/78 (30%), Positives = 39/78 (50%) Frame = +1 Query: 253 IEDYGIVINPAKCVFGAPEVTFLGNRISADGTQPPSERIQALKDFPLPQTVQGLRRFIGM 432 +ED G ++ K P+V +LG I SER Q + P P++ + +R+F+G Sbjct: 356 LEDCGYKVSKKKAQICRPQVRYLGFTIRQGERSLGSERKQVICTLPEPKSRKQVRKFLGA 415 Query: 433 VNYYRRFLRNAAKLQAPL 486 + R ++ N A L PL Sbjct: 416 AGFCRLWIPNFAVLAKPL 433 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 91,090,816 Number of Sequences: 237096 Number of extensions: 1811697 Number of successful extensions: 3141 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 3033 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3138 length of database: 76,859,062 effective HSP length: 88 effective length of database: 55,994,614 effective search space used: 7671262118 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -