BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV120012.Seq (701 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value BC064404-1|AAH64404.1| 719|Homo sapiens nucleolar protein 11 pr... 32 1.7 BC001726-1|AAH01726.2| 408|Homo sapiens NOL11 protein protein. 32 1.7 AY598333-1|AAT06744.1| 719|Homo sapiens L14 protein. 32 1.7 AL110271-1|CAB53709.1| 314|Homo sapiens hypothetical protein pr... 32 1.7 AK023702-1|BAB14647.1| 719|Homo sapiens protein ( Homo sapiens ... 32 1.7 >BC064404-1|AAH64404.1| 719|Homo sapiens nucleolar protein 11 protein. Length = 719 Score = 32.3 bits (70), Expect = 1.7 Identities = 18/47 (38%), Positives = 23/47 (48%) Frame = -3 Query: 282 SPCFATLFGARAVVSPPTRCTYICIFYPRVCLQRLYNFHILNCWRCP 142 +P F T+ G V RC FYPR CL +L H+L+ CP Sbjct: 426 TPDFHTVIGD-TVTGLLERCKAEPSFYPRNCLMQLIQTHVLSYSLCP 471 >BC001726-1|AAH01726.2| 408|Homo sapiens NOL11 protein protein. Length = 408 Score = 32.3 bits (70), Expect = 1.7 Identities = 18/47 (38%), Positives = 23/47 (48%) Frame = -3 Query: 282 SPCFATLFGARAVVSPPTRCTYICIFYPRVCLQRLYNFHILNCWRCP 142 +P F T+ G V RC FYPR CL +L H+L+ CP Sbjct: 115 TPDFHTVIGD-TVTGLLERCKAEPSFYPRNCLMQLIQTHVLSYSLCP 160 >AY598333-1|AAT06744.1| 719|Homo sapiens L14 protein. Length = 719 Score = 32.3 bits (70), Expect = 1.7 Identities = 18/47 (38%), Positives = 23/47 (48%) Frame = -3 Query: 282 SPCFATLFGARAVVSPPTRCTYICIFYPRVCLQRLYNFHILNCWRCP 142 +P F T+ G V RC FYPR CL +L H+L+ CP Sbjct: 426 TPDFHTVIGD-TVTGLLERCKAEPSFYPRNCLMQLIQTHVLSYSLCP 471 >AL110271-1|CAB53709.1| 314|Homo sapiens hypothetical protein protein. Length = 314 Score = 32.3 bits (70), Expect = 1.7 Identities = 18/47 (38%), Positives = 23/47 (48%) Frame = -3 Query: 282 SPCFATLFGARAVVSPPTRCTYICIFYPRVCLQRLYNFHILNCWRCP 142 +P F T+ G V RC FYPR CL +L H+L+ CP Sbjct: 21 TPDFHTVIGD-TVTGLLERCKAEPSFYPRNCLMQLIQTHVLSYSLCP 66 >AK023702-1|BAB14647.1| 719|Homo sapiens protein ( Homo sapiens cDNA FLJ13640 fis, clone PLACE1011221. ). Length = 719 Score = 32.3 bits (70), Expect = 1.7 Identities = 18/47 (38%), Positives = 23/47 (48%) Frame = -3 Query: 282 SPCFATLFGARAVVSPPTRCTYICIFYPRVCLQRLYNFHILNCWRCP 142 +P F T+ G V RC FYPR CL +L H+L+ CP Sbjct: 426 TPDFHTVIGD-TVTGLLERCKAEPSFYPRNCLMQLIQTHVLSYSLCP 471 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 97,111,292 Number of Sequences: 237096 Number of extensions: 1942364 Number of successful extensions: 3879 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 3699 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3879 length of database: 76,859,062 effective HSP length: 88 effective length of database: 55,994,614 effective search space used: 8119219030 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -