BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV120008.Seq (681 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY957503-1|AAY41942.1| 596|Anopheles gambiae vasa-like protein ... 81 3e-17 AY239359-1|AAO73809.1| 2259|Anopheles gambiae dicer-1 protein. 25 2.9 AY263175-1|AAP78790.1| 814|Anopheles gambiae TmcA-like protein ... 23 8.9 AJ441131-8|CAD29637.1| 756|Anopheles gambiae putative 5-oxoprol... 23 8.9 AJ441131-7|CAD29636.1| 1977|Anopheles gambiae putative Tyr/Ser/T... 23 8.9 AJ439398-7|CAD28130.1| 1344|Anopheles gambiae putative 5-oxoprol... 23 8.9 AJ439398-6|CAD28129.1| 1978|Anopheles gambiae putative Tyr/Ser/T... 23 8.9 >AY957503-1|AAY41942.1| 596|Anopheles gambiae vasa-like protein protein. Length = 596 Score = 81.0 bits (191), Expect = 3e-17 Identities = 38/82 (46%), Positives = 57/82 (69%), Gaps = 4/82 (4%) Frame = +2 Query: 257 GRLIDFLEKGTTNLQRCTYLVLDEADRMLDMGFEPQIRKIIEQI----RPDRQTLMWSAT 424 GRL+DF+++G + ++VLDEADRMLDMGF P I K++ + RQTLM+SAT Sbjct: 308 GRLLDFIDRGYVTFENVNFVVLDEADRMLDMGFLPSIEKVMGHATMPEKQQRQTLMFSAT 367 Query: 425 WPKEVKKLAEDYLGDYIQINIG 490 +P E+++LA +L +YI + +G Sbjct: 368 FPAEIQELAGKFLHNYICVFVG 389 Score = 54.0 bits (124), Expect = 4e-09 Identities = 29/86 (33%), Positives = 48/86 (55%), Gaps = 2/86 (2%) Frame = +3 Query: 3 GSGKTLAYILPAIVHI-NNQPPIR-RGDGPIALVLAPTRELAQQIQQVAADFGHTSYVRN 176 GSGKT A++LP I H+ + + + R P +++APTRELA QI F H + ++ Sbjct: 221 GSGKTAAFMLPMIHHLLDKEDSLELRTRNPYIVIVAPTRELAIQIHDEGRKFAHGTKLKV 280 Query: 177 TCVFGGAPKREQARDLERGVEIVIAT 254 +GG + Q + + G +++AT Sbjct: 281 CVSYGGTAVQHQLQLMRGGCHVLVAT 306 >AY239359-1|AAO73809.1| 2259|Anopheles gambiae dicer-1 protein. Length = 2259 Score = 24.6 bits (51), Expect = 2.9 Identities = 8/25 (32%), Positives = 17/25 (68%) Frame = +2 Query: 263 LIDFLEKGTTNLQRCTYLVLDEADR 337 L+ ++E+GT +Q + L++DE + Sbjct: 133 LLQYIEQGTVRVQDISLLIVDECHK 157 >AY263175-1|AAP78790.1| 814|Anopheles gambiae TmcA-like protein protein. Length = 814 Score = 23.0 bits (47), Expect = 8.9 Identities = 8/19 (42%), Positives = 10/19 (52%) Frame = +3 Query: 318 FLMRLIVCWIWDLNHKSEK 374 F+ + CW WDL K K Sbjct: 515 FVRYMNSCWCWDLEKKFPK 533 >AJ441131-8|CAD29637.1| 756|Anopheles gambiae putative 5-oxoprolinase protein. Length = 756 Score = 23.0 bits (47), Expect = 8.9 Identities = 9/25 (36%), Positives = 15/25 (60%) Frame = -1 Query: 186 THTCYEHKMCVQNLQQLAEFVVLTL 112 ++ C EH++CV + Q F +TL Sbjct: 199 SYACPEHELCVGRIAQELGFQHVTL 223 >AJ441131-7|CAD29636.1| 1977|Anopheles gambiae putative Tyr/Ser/Thr phosphatase protein. Length = 1977 Score = 23.0 bits (47), Expect = 8.9 Identities = 8/27 (29%), Positives = 17/27 (62%) Frame = +2 Query: 392 PDRQTLMWSATWPKEVKKLAEDYLGDY 472 P+R+ ++W A ++++ E YLG + Sbjct: 559 PNRERVLWPAHNVRDLRLWTEVYLGSW 585 >AJ439398-7|CAD28130.1| 1344|Anopheles gambiae putative 5-oxoprolinase protein. Length = 1344 Score = 23.0 bits (47), Expect = 8.9 Identities = 9/25 (36%), Positives = 15/25 (60%) Frame = -1 Query: 186 THTCYEHKMCVQNLQQLAEFVVLTL 112 ++ C EH++CV + Q F +TL Sbjct: 199 SYACPEHELCVGRIAQELGFQHVTL 223 >AJ439398-6|CAD28129.1| 1978|Anopheles gambiae putative Tyr/Ser/Thr phosphatase protein. Length = 1978 Score = 23.0 bits (47), Expect = 8.9 Identities = 8/27 (29%), Positives = 17/27 (62%) Frame = +2 Query: 392 PDRQTLMWSATWPKEVKKLAEDYLGDY 472 P+R+ ++W A ++++ E YLG + Sbjct: 559 PNRERVLWPAHNVRDLRLWTEVYLGSW 585 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 736,359 Number of Sequences: 2352 Number of extensions: 16078 Number of successful extensions: 29 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 26 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 27 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 68577420 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -