BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV120005.Seq (647 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC1F8.03c |str3||siderophore-iron transporter Str3 |Schizosacc... 31 0.11 SPAC23G3.02c |sib1||ferrichrome synthetase Sib1|Schizosaccharomy... 27 3.1 SPAC4G9.08c |rpc2||DNA-directed RNA polymerase III complex subun... 26 4.1 >SPAC1F8.03c |str3||siderophore-iron transporter Str3 |Schizosaccharomyces pombe|chr 1|||Manual Length = 630 Score = 31.5 bits (68), Expect = 0.11 Identities = 16/57 (28%), Positives = 26/57 (45%) Frame = +3 Query: 240 PHQTFKMSKMVLPIFDEDDNQFKMTIARHLVGNKERGIKRILIPSATNYQEVFNLNS 410 PHQ ++ +LP++ IA + NK R +PS+ N +V+N S Sbjct: 493 PHQDLAIASSLLPLYTNIGGAIGAAIASPIFSNKVPKYLREYLPSSINDTQVYNFYS 549 >SPAC23G3.02c |sib1||ferrichrome synthetase Sib1|Schizosaccharomyces pombe|chr 1|||Manual Length = 4924 Score = 26.6 bits (56), Expect = 3.1 Identities = 10/37 (27%), Positives = 21/37 (56%) Frame = +3 Query: 237 PPHQTFKMSKMVLPIFDEDDNQFKMTIARHLVGNKER 347 P H F + ++ +F+++ N+ +IA H V N ++ Sbjct: 1741 PIHTNFDTNADIITLFEKEANEHPSSIALHFVYNVDK 1777 >SPAC4G9.08c |rpc2||DNA-directed RNA polymerase III complex subunit Rpc2|Schizosaccharomyces pombe|chr 1|||Manual Length = 1165 Score = 26.2 bits (55), Expect = 4.1 Identities = 9/38 (23%), Positives = 17/38 (44%) Frame = +1 Query: 94 MPVGMAPRQMRVNRCIFASIVSFDACITYKSPCSPDAY 207 +P+G P +R N+C+ + + + P P Y Sbjct: 155 VPIGRMPVMLRSNKCVLSGKNEMEMAALNECPLDPGGY 192 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,622,918 Number of Sequences: 5004 Number of extensions: 51339 Number of successful extensions: 118 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 110 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 118 length of database: 2,362,478 effective HSP length: 70 effective length of database: 2,012,198 effective search space used: 291768710 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -