BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV120003.Seq (731 letters) Database: fruitfly 53,049 sequences; 24,988,368 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value U45881-1|AAC46988.1| 498|Drosophila melanogaster inhibitor of a... 34 0.23 U38809-1|AAB08398.1| 482|Drosophila melanogaster DIHA protein. 34 0.23 U32373-1|AAC47155.1| 497|Drosophila melanogaster IAP-like prote... 34 0.23 L49441-1|AAC41610.1| 498|Drosophila melanogaster apoptosis 2 in... 34 0.23 AY051844-1|AAK93268.1| 498|Drosophila melanogaster LD34777p pro... 34 0.23 AE013599-2132|AAO41389.1| 498|Drosophila melanogaster CG8293-PB... 34 0.23 AE013599-2131|AAF58095.1| 498|Drosophila melanogaster CG8293-PA... 34 0.23 >U45881-1|AAC46988.1| 498|Drosophila melanogaster inhibitor of apoptosis protein protein. Length = 498 Score = 33.9 bits (74), Expect = 0.23 Identities = 12/48 (25%), Positives = 25/48 (52%) Frame = +1 Query: 523 NSLIVNGFKYNQVDDHVVCEYCEAEIKNWSEDECIEYAHVTLSPYCAY 666 ++L G Y ++ D V C +C +++W +++ + H SP C + Sbjct: 231 SALAQAGLYYQKIGDQVRCFHCNIGLRSWQKEDEPWFEHAKWSPKCQF 278 Score = 30.3 bits (65), Expect = 2.8 Identities = 13/40 (32%), Positives = 17/40 (42%) Frame = +1 Query: 541 GFKYNQVDDHVVCEYCEAEIKNWSEDECIEYAHVTLSPYC 660 GF Y DHV C +C I W +++ H P C Sbjct: 137 GFYYLNRLDHVKCVWCNGVIAKWEKNDNAFEEHKRFFPQC 176 >U38809-1|AAB08398.1| 482|Drosophila melanogaster DIHA protein. Length = 482 Score = 33.9 bits (74), Expect = 0.23 Identities = 12/48 (25%), Positives = 25/48 (52%) Frame = +1 Query: 523 NSLIVNGFKYNQVDDHVVCEYCEAEIKNWSEDECIEYAHVTLSPYCAY 666 ++L G Y ++ D V C +C +++W +++ + H SP C + Sbjct: 215 SALAQAGLYYQKIGDQVRCFHCNIGLRSWQKEDEPWFEHAKWSPKCQF 262 Score = 30.3 bits (65), Expect = 2.8 Identities = 13/40 (32%), Positives = 17/40 (42%) Frame = +1 Query: 541 GFKYNQVDDHVVCEYCEAEIKNWSEDECIEYAHVTLSPYC 660 GF Y DHV C +C I W +++ H P C Sbjct: 121 GFYYLNRLDHVKCVWCNGVIAKWEKNDNAFEEHKRFFPQC 160 >U32373-1|AAC47155.1| 497|Drosophila melanogaster IAP-like protein ILP protein. Length = 497 Score = 33.9 bits (74), Expect = 0.23 Identities = 12/48 (25%), Positives = 25/48 (52%) Frame = +1 Query: 523 NSLIVNGFKYNQVDDHVVCEYCEAEIKNWSEDECIEYAHVTLSPYCAY 666 ++L G Y ++ D V C +C +++W +++ + H SP C + Sbjct: 231 SALAQAGLYYQKIGDQVRCFHCNIGLRSWQKEDEPWFEHAKWSPKCQF 278 Score = 30.3 bits (65), Expect = 2.8 Identities = 13/40 (32%), Positives = 17/40 (42%) Frame = +1 Query: 541 GFKYNQVDDHVVCEYCEAEIKNWSEDECIEYAHVTLSPYC 660 GF Y DHV C +C I W +++ H P C Sbjct: 137 GFYYLNRLDHVKCVWCNGVIAKWEKNDNAFEEHKRFFPQC 176 >L49441-1|AAC41610.1| 498|Drosophila melanogaster apoptosis 2 inhibitor protein. Length = 498 Score = 33.9 bits (74), Expect = 0.23 Identities = 12/48 (25%), Positives = 25/48 (52%) Frame = +1 Query: 523 NSLIVNGFKYNQVDDHVVCEYCEAEIKNWSEDECIEYAHVTLSPYCAY 666 ++L G Y ++ D V C +C +++W +++ + H SP C + Sbjct: 231 SALAQAGLYYQKIGDQVRCFHCNIGLRSWQKEDEPWFEHAKWSPKCQF 278 Score = 30.3 bits (65), Expect = 2.8 Identities = 13/40 (32%), Positives = 17/40 (42%) Frame = +1 Query: 541 GFKYNQVDDHVVCEYCEAEIKNWSEDECIEYAHVTLSPYC 660 GF Y DHV C +C I W +++ H P C Sbjct: 137 GFYYLNRLDHVKCVWCNGVIAKWEKNDNAFEEHKRFFPQC 176 >AY051844-1|AAK93268.1| 498|Drosophila melanogaster LD34777p protein. Length = 498 Score = 33.9 bits (74), Expect = 0.23 Identities = 12/48 (25%), Positives = 25/48 (52%) Frame = +1 Query: 523 NSLIVNGFKYNQVDDHVVCEYCEAEIKNWSEDECIEYAHVTLSPYCAY 666 ++L G Y ++ D V C +C +++W +++ + H SP C + Sbjct: 231 SALAQAGLYYQKIGDQVRCFHCNIGLRSWQKEDEPWFEHAKWSPKCQF 278 Score = 30.3 bits (65), Expect = 2.8 Identities = 13/40 (32%), Positives = 17/40 (42%) Frame = +1 Query: 541 GFKYNQVDDHVVCEYCEAEIKNWSEDECIEYAHVTLSPYC 660 GF Y DHV C +C I W +++ H P C Sbjct: 137 GFYYLNRLDHVKCVWCNGVIAKWEKNDNAFEEHKRFFPQC 176 >AE013599-2132|AAO41389.1| 498|Drosophila melanogaster CG8293-PB, isoform B protein. Length = 498 Score = 33.9 bits (74), Expect = 0.23 Identities = 12/48 (25%), Positives = 25/48 (52%) Frame = +1 Query: 523 NSLIVNGFKYNQVDDHVVCEYCEAEIKNWSEDECIEYAHVTLSPYCAY 666 ++L G Y ++ D V C +C +++W +++ + H SP C + Sbjct: 231 SALAQAGLYYQKIGDQVRCFHCNIGLRSWQKEDEPWFEHAKWSPKCQF 278 Score = 30.3 bits (65), Expect = 2.8 Identities = 13/40 (32%), Positives = 17/40 (42%) Frame = +1 Query: 541 GFKYNQVDDHVVCEYCEAEIKNWSEDECIEYAHVTLSPYC 660 GF Y DHV C +C I W +++ H P C Sbjct: 137 GFYYLNRLDHVKCVWCNGVIAKWEKNDNAFEEHKRFFPQC 176 >AE013599-2131|AAF58095.1| 498|Drosophila melanogaster CG8293-PA, isoform A protein. Length = 498 Score = 33.9 bits (74), Expect = 0.23 Identities = 12/48 (25%), Positives = 25/48 (52%) Frame = +1 Query: 523 NSLIVNGFKYNQVDDHVVCEYCEAEIKNWSEDECIEYAHVTLSPYCAY 666 ++L G Y ++ D V C +C +++W +++ + H SP C + Sbjct: 231 SALAQAGLYYQKIGDQVRCFHCNIGLRSWQKEDEPWFEHAKWSPKCQF 278 Score = 30.3 bits (65), Expect = 2.8 Identities = 13/40 (32%), Positives = 17/40 (42%) Frame = +1 Query: 541 GFKYNQVDDHVVCEYCEAEIKNWSEDECIEYAHVTLSPYC 660 GF Y DHV C +C I W +++ H P C Sbjct: 137 GFYYLNRLDHVKCVWCNGVIAKWEKNDNAFEEHKRFFPQC 176 Database: fruitfly Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 24,988,368 Number of sequences in database: 53,049 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 29,080,820 Number of Sequences: 53049 Number of extensions: 565472 Number of successful extensions: 1962 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 1906 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1962 length of database: 24,988,368 effective HSP length: 83 effective length of database: 20,585,301 effective search space used: 3293648160 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -