BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV060987.seq (656 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AJ223627-1|CAA11500.1| 371|Tribolium castaneum orthodenticle-1 ... 27 0.14 AY490815-1|AAR82970.1| 136|Tribolium castaneum glass protein pr... 22 3.9 AY293621-1|AAP46162.1| 392|Tribolium castaneum glass protein pr... 22 3.9 AY884065-1|AAX84206.1| 697|Tribolium castaneum laccase 1 protein. 21 6.7 AJ307577-1|CAC84070.1| 301|Tribolium castaneum dachshund protein. 21 6.7 >AJ223627-1|CAA11500.1| 371|Tribolium castaneum orthodenticle-1 protein protein. Length = 371 Score = 27.1 bits (57), Expect = 0.14 Identities = 13/36 (36%), Positives = 19/36 (52%) Frame = +2 Query: 419 PSRQPPTAESGLGGSVAATGVPALRSG*RTIIEKIP 526 P P+ SGLGG ++ +PAL G +E +P Sbjct: 76 PYAPHPSLSSGLGGGLSGMPMPALGFGLGHPLESVP 111 >AY490815-1|AAR82970.1| 136|Tribolium castaneum glass protein protein. Length = 136 Score = 22.2 bits (45), Expect = 3.9 Identities = 9/18 (50%), Positives = 11/18 (61%) Frame = +1 Query: 418 TVASTSDSGERPWRQRCC 471 T + SGERP+R R C Sbjct: 66 TTHMRTHSGERPYRCRLC 83 >AY293621-1|AAP46162.1| 392|Tribolium castaneum glass protein protein. Length = 392 Score = 22.2 bits (45), Expect = 3.9 Identities = 9/18 (50%), Positives = 11/18 (61%) Frame = +1 Query: 418 TVASTSDSGERPWRQRCC 471 T + SGERP+R R C Sbjct: 322 TTHMRTHSGERPYRCRLC 339 >AY884065-1|AAX84206.1| 697|Tribolium castaneum laccase 1 protein. Length = 697 Score = 21.4 bits (43), Expect = 6.7 Identities = 10/34 (29%), Positives = 13/34 (38%), Gaps = 3/34 (8%) Frame = -3 Query: 354 HPDRTYEYH---HHGHAEFGRQHVQYPMIQHWFG 262 HP T+ YH H+ F H + FG Sbjct: 158 HPGMTFRYHFNVHNSGTHFWHSHSGFQRSDGTFG 191 >AJ307577-1|CAC84070.1| 301|Tribolium castaneum dachshund protein. Length = 301 Score = 21.4 bits (43), Expect = 6.7 Identities = 7/14 (50%), Positives = 11/14 (78%) Frame = -2 Query: 142 HPAPSHSSLNTPTL 101 HPA +HS+L +P + Sbjct: 121 HPAAAHSALLSPAM 134 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 139,217 Number of Sequences: 336 Number of extensions: 2878 Number of successful extensions: 6 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 16969115 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -