BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV060979.seq (678 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 04_03_0019 + 9457336-9457839 28 6.0 02_05_0366 - 28313190-28313601,28313759-28314225,28315044-283157... 28 6.0 07_01_0184 - 1304328-1304951,1305328-1305441,1305549-1305839,130... 28 7.9 03_06_0109 - 31717691-31718311,31719110-31719223,31719316-317196... 28 7.9 >04_03_0019 + 9457336-9457839 Length = 167 Score = 28.3 bits (60), Expect = 6.0 Identities = 18/63 (28%), Positives = 32/63 (50%), Gaps = 3/63 (4%) Frame = +2 Query: 470 QAFNVT*RTYRKRQEDNFPKTR---QSKLSTFXRLRRKVACNGQRFNSLPVSEVSRIAEK 640 +AFN+ RK + +FP + S+LST L+ K +C G+ N+ + V + + Sbjct: 34 KAFNMNGLYTRKGYQVHFPSDQTACHSELSTNGNLKLKTSCAGRTGNAQVTTMVMNVGFE 93 Query: 641 RFI 649 R + Sbjct: 94 RHV 96 >02_05_0366 - 28313190-28313601,28313759-28314225,28315044-28315782, 28316548-28316615,28316693-28316757,28316922-28320162, 28320239-28320301,28320756-28320824,28321020-28321055, 28322035-28322280,28322531-28322569,28322695-28322816, 28322921-28323004,28323100-28323235,28323486-28323535, 28323620-28323756,28323863-28323951,28324847-28324954, 28325080-28325163,28325841-28325888,28326036-28326153, 28328262-28328347 Length = 2168 Score = 28.3 bits (60), Expect = 6.0 Identities = 13/31 (41%), Positives = 19/31 (61%) Frame = +2 Query: 95 PYCFFLFTESLTNLIFGSLLNYFKIILDILE 187 P C F+ SL NL+ S ++ FK +LD +E Sbjct: 1106 PLCHMEFSSSLANLVLSS-VDRFKTMLDFIE 1135 >07_01_0184 - 1304328-1304951,1305328-1305441,1305549-1305839, 1305930-1306238,1306326-1307048 Length = 686 Score = 27.9 bits (59), Expect = 7.9 Identities = 11/20 (55%), Positives = 15/20 (75%) Frame = +3 Query: 57 RCNYIFIFFFLKNLIVFFYS 116 + N IF+FF L+ LI+ FYS Sbjct: 485 KANLIFLFFLLRKLILPFYS 504 >03_06_0109 - 31717691-31718311,31719110-31719223,31719316-31719606, 31719698-31720006,31720098-31720865 Length = 700 Score = 27.9 bits (59), Expect = 7.9 Identities = 11/20 (55%), Positives = 15/20 (75%) Frame = +3 Query: 57 RCNYIFIFFFLKNLIVFFYS 116 + N IF+FF L+ LI+ FYS Sbjct: 500 KANLIFLFFLLRKLILPFYS 519 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,995,994 Number of Sequences: 37544 Number of extensions: 267455 Number of successful extensions: 626 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 612 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 626 length of database: 14,793,348 effective HSP length: 79 effective length of database: 11,827,372 effective search space used: 1726796312 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -