BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV060978.seq (685 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AJ547798-1|CAD67999.1| 587|Apis mellifera octopamine receptor p... 23 2.7 DQ342041-1|ABC69933.1| 828|Apis mellifera STIP protein. 23 3.6 DQ058012-1|AAY57281.1| 373|Apis mellifera venom allergen acid p... 23 3.6 AY939855-1|AAX33235.1| 388|Apis mellifera venom acid phosphatas... 23 3.6 AY540846-1|AAS48080.1| 541|Apis mellifera neuronal nicotinic ac... 23 3.6 AF205594-1|AAQ13840.1| 156|Apis mellifera acid phosphatase prec... 23 3.6 AY338499-1|AAR08420.1| 500|Apis mellifera Kruppel-like protein ... 22 4.7 U26026-1|AAA69069.1| 377|Apis mellifera long-wavelength rhodops... 21 8.3 DQ667181-1|ABG75733.1| 445|Apis mellifera GABA-gated chloride c... 21 8.3 AF091732-1|AAD02869.2| 154|Apis mellifera long-wavelength rhodo... 21 8.3 AB231585-1|BAE17127.1| 898|Apis mellifera Mahya protein. 21 8.3 AB022907-1|BAA86908.1| 615|Apis mellifera glucose oxidase protein. 21 8.3 >AJ547798-1|CAD67999.1| 587|Apis mellifera octopamine receptor protein. Length = 587 Score = 23.0 bits (47), Expect = 2.7 Identities = 15/51 (29%), Positives = 26/51 (50%) Frame = +2 Query: 521 VPLSSYMEDLLTNKISLNAGQRKASYRMGYRGSSTLKLRELASSACKSTDE 673 +P+ S+ E + + S +G R +R S K+REL ++AC + E Sbjct: 9 LPVKSFRESRCSVRCSAASGLRWFEI---WRDSLPTKMRELNATACAALYE 56 >DQ342041-1|ABC69933.1| 828|Apis mellifera STIP protein. Length = 828 Score = 22.6 bits (46), Expect = 3.6 Identities = 7/11 (63%), Positives = 9/11 (81%) Frame = +3 Query: 294 KWFFPRWAQAL 326 K+FFP+W Q L Sbjct: 648 KFFFPKWLQVL 658 >DQ058012-1|AAY57281.1| 373|Apis mellifera venom allergen acid phosphatase protein. Length = 373 Score = 22.6 bits (46), Expect = 3.6 Identities = 9/18 (50%), Positives = 13/18 (72%) Frame = -2 Query: 84 GSLRLKIIFTYHITDTTP 31 G L +FTY+IT++TP Sbjct: 202 GELFDATVFTYNITNSTP 219 >AY939855-1|AAX33235.1| 388|Apis mellifera venom acid phosphatase precursor protein. Length = 388 Score = 22.6 bits (46), Expect = 3.6 Identities = 9/18 (50%), Positives = 13/18 (72%) Frame = -2 Query: 84 GSLRLKIIFTYHITDTTP 31 G L +FTY+IT++TP Sbjct: 217 GELFDATVFTYNITNSTP 234 >AY540846-1|AAS48080.1| 541|Apis mellifera neuronal nicotinic acetylcholine receptorApisa2 subunit protein. Length = 541 Score = 22.6 bits (46), Expect = 3.6 Identities = 11/26 (42%), Positives = 15/26 (57%) Frame = -3 Query: 662 FYRLNLQAPLISVSNFPYNPFYSLPS 585 FY +NL P +S+S FY LP+ Sbjct: 237 FYTVNLIVPCVSISYLSVLAFY-LPA 261 >AF205594-1|AAQ13840.1| 156|Apis mellifera acid phosphatase precursor protein. Length = 156 Score = 22.6 bits (46), Expect = 3.6 Identities = 9/18 (50%), Positives = 13/18 (72%) Frame = -2 Query: 84 GSLRLKIIFTYHITDTTP 31 G L +FTY+IT++TP Sbjct: 105 GELFDATVFTYNITNSTP 122 >AY338499-1|AAR08420.1| 500|Apis mellifera Kruppel-like protein 1 protein. Length = 500 Score = 22.2 bits (45), Expect = 4.7 Identities = 9/27 (33%), Positives = 16/27 (59%) Frame = +1 Query: 442 KLYGILHILQIPQKHY*NKKL*YCTRC 522 K +G H+L++ Q + +K+ CT C Sbjct: 239 KSFGYNHVLKLHQVAHYGEKVYKCTLC 265 >U26026-1|AAA69069.1| 377|Apis mellifera long-wavelength rhodopsin protein. Length = 377 Score = 21.4 bits (43), Expect = 8.3 Identities = 9/32 (28%), Positives = 11/32 (34%) Frame = +1 Query: 154 FNHPWETVAQAAWRKYPNPMNPAVIGTDVVER 249 F+ W W +Y N GTD R Sbjct: 178 FSLGWTIAPMFGWNRYVPEGNMTACGTDYFNR 209 >DQ667181-1|ABG75733.1| 445|Apis mellifera GABA-gated chloride channel protein. Length = 445 Score = 21.4 bits (43), Expect = 8.3 Identities = 7/10 (70%), Positives = 8/10 (80%) Frame = +2 Query: 137 GHQNTHSTIH 166 GH+ HSTIH Sbjct: 192 GHRQRHSTIH 201 >AF091732-1|AAD02869.2| 154|Apis mellifera long-wavelength rhodopsin protein. Length = 154 Score = 21.4 bits (43), Expect = 8.3 Identities = 9/32 (28%), Positives = 11/32 (34%) Frame = +1 Query: 154 FNHPWETVAQAAWRKYPNPMNPAVIGTDVVER 249 F+ W W +Y N GTD R Sbjct: 54 FSLGWTIAPMFGWNRYVPEGNMTACGTDYFNR 85 >AB231585-1|BAE17127.1| 898|Apis mellifera Mahya protein. Length = 898 Score = 21.4 bits (43), Expect = 8.3 Identities = 6/13 (46%), Positives = 10/13 (76%) Frame = -3 Query: 569 EKFCWLKGLPCNY 531 E C +KG+PC++ Sbjct: 539 EHVCGVKGIPCSW 551 >AB022907-1|BAA86908.1| 615|Apis mellifera glucose oxidase protein. Length = 615 Score = 21.4 bits (43), Expect = 8.3 Identities = 7/18 (38%), Positives = 10/18 (55%) Frame = -1 Query: 544 FHVTTERHTLYSTTASCF 491 ++ T E H ST SC+ Sbjct: 126 YYTTNESHACLSTGGSCY 143 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 198,174 Number of Sequences: 438 Number of extensions: 4396 Number of successful extensions: 19 Number of sequences better than 10.0: 12 Number of HSP's better than 10.0 without gapping: 19 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 19 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 20830365 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -