BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV060974.seq (450 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_31692| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.1 SB_26973| Best HMM Match : DUF471 (HMM E-Value=1.1) 28 4.1 SB_39862| Best HMM Match : PAN (HMM E-Value=0.24) 27 9.5 >SB_31692| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 598 Score = 27.9 bits (59), Expect = 4.1 Identities = 11/18 (61%), Positives = 12/18 (66%), Gaps = 1/18 (5%) Frame = -1 Query: 159 HLKNCAHEH-HRLXPDCN 109 H KNCAHE H P+CN Sbjct: 156 HAKNCAHEDVHCTNPECN 173 >SB_26973| Best HMM Match : DUF471 (HMM E-Value=1.1) Length = 674 Score = 27.9 bits (59), Expect = 4.1 Identities = 13/47 (27%), Positives = 23/47 (48%), Gaps = 4/47 (8%) Frame = +2 Query: 125 KRWCSCAQFFKCQICKM---RNADRIVYDNR-AGQGCLAVCPSRVPE 253 ++W C +++KC C ++A R D G+ C +C VP+ Sbjct: 342 QKWTFCQRYYKCNDCGKSVDKSAQREDGDEHVCGEYCCNICKQLVPQ 388 >SB_39862| Best HMM Match : PAN (HMM E-Value=0.24) Length = 146 Score = 26.6 bits (56), Expect = 9.5 Identities = 10/18 (55%), Positives = 13/18 (72%) Frame = -1 Query: 156 LKNCAHEHHRLXPDCNYL 103 L +CAHE +L P CNY+ Sbjct: 62 LISCAHECLKLFPRCNYI 79 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,862,185 Number of Sequences: 59808 Number of extensions: 194177 Number of successful extensions: 344 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 308 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 339 length of database: 16,821,457 effective HSP length: 76 effective length of database: 12,276,049 effective search space used: 896151577 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -