BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV060973.seq (691 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AJ968562-1|CAI91546.1| 998|Apis mellifera protein ( Apis mellif... 23 2.7 AB231585-1|BAE17127.1| 898|Apis mellifera Mahya protein. 23 2.7 DQ667187-1|ABG75739.1| 428|Apis mellifera histamine-gated chlor... 21 8.4 >AJ968562-1|CAI91546.1| 998|Apis mellifera protein ( Apis mellifera ORF for hypotheticalprotein. ). Length = 998 Score = 23.0 bits (47), Expect = 2.7 Identities = 24/77 (31%), Positives = 36/77 (46%) Frame = +1 Query: 148 KACFHIPSSGRAGNVELNHSATSLQIFMERLCREREVQRRDYLCVRKLLLLKGVLDEKNA 327 KA IP V L+ SA L + L + QRR +L R+ L ++ V++E++ Sbjct: 174 KAPAQIPVDVLVLTVTLSASAMVLGLSSYSLTEFQ--QRRAFLETRQSLEVQLVIEEQST 231 Query: 328 RC*SLYLSVCRCHLKFK 378 L LSV H+ K Sbjct: 232 EQERLLLSVLPEHVAVK 248 >AB231585-1|BAE17127.1| 898|Apis mellifera Mahya protein. Length = 898 Score = 23.0 bits (47), Expect = 2.7 Identities = 10/20 (50%), Positives = 13/20 (65%) Frame = -1 Query: 661 CMQQIAKKTFRNLRTTSTYV 602 CM +IA ++F L STYV Sbjct: 3 CMLEIAARSFLLLSIASTYV 22 >DQ667187-1|ABG75739.1| 428|Apis mellifera histamine-gated chloride channel protein. Length = 428 Score = 21.4 bits (43), Expect = 8.4 Identities = 7/17 (41%), Positives = 12/17 (70%) Frame = +2 Query: 188 TLN*ITLPHHYKFLWND 238 T +T+P+HY +L+ D Sbjct: 132 TFQTMTIPNHYLWLYKD 148 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 195,336 Number of Sequences: 438 Number of extensions: 4542 Number of successful extensions: 11 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 11 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 11 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 21073995 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -