BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV060972.seq (684 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY943929-1|AAX49502.1| 755|Anopheles gambiae laccase-2 isoform ... 24 3.9 AY943928-1|AAX49501.1| 753|Anopheles gambiae laccase-2 isoform ... 24 3.9 DQ974169-1|ABJ52809.1| 508|Anopheles gambiae serpin 11 protein. 23 9.0 AJ438610-1|CAD27473.1| 838|Anopheles gambiae putative microtubu... 23 9.0 >AY943929-1|AAX49502.1| 755|Anopheles gambiae laccase-2 isoform B protein. Length = 755 Score = 24.2 bits (50), Expect = 3.9 Identities = 9/27 (33%), Positives = 16/27 (59%) Frame = -3 Query: 310 GQPPAVCHRHLFR*HWFDLVGAFFDPC 230 G+PP +C+ H F ++ ++GA C Sbjct: 158 GEPPRICYYH-FTVEYYTVLGAACQVC 183 >AY943928-1|AAX49501.1| 753|Anopheles gambiae laccase-2 isoform A protein. Length = 753 Score = 24.2 bits (50), Expect = 3.9 Identities = 9/27 (33%), Positives = 16/27 (59%) Frame = -3 Query: 310 GQPPAVCHRHLFR*HWFDLVGAFFDPC 230 G+PP +C+ H F ++ ++GA C Sbjct: 158 GEPPRICYYH-FTVEYYTVLGAACQVC 183 >DQ974169-1|ABJ52809.1| 508|Anopheles gambiae serpin 11 protein. Length = 508 Score = 23.0 bits (47), Expect = 9.0 Identities = 11/43 (25%), Positives = 23/43 (53%), Gaps = 1/43 (2%) Frame = +2 Query: 155 SIK*QRIMVSTMATSSPDFLHDRMHTWIKECAHQ-VEPVLSEE 280 S+K + +S M S+P + ++ W +E Q ++ V+ E+ Sbjct: 229 SLKSNHVPLSEMDFSNPRLASETINNWAREKTRQRIQEVVDEK 271 >AJ438610-1|CAD27473.1| 838|Anopheles gambiae putative microtubule binding protein protein. Length = 838 Score = 23.0 bits (47), Expect = 9.0 Identities = 10/30 (33%), Positives = 13/30 (43%) Frame = -2 Query: 509 RNRFPVMTRWCHSKRSGPARLPPVQQHAPP 420 R P + H + +GPA P H PP Sbjct: 136 RPLLPQQQQHPHQRDTGPALFPAPISHRPP 165 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 648,682 Number of Sequences: 2352 Number of extensions: 11953 Number of successful extensions: 22 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 21 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 22 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 68995575 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -