BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV060965.seq (691 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_16431| Best HMM Match : No HMM Matches (HMM E-Value=.) 81 1e-15 SB_18993| Best HMM Match : DEAD (HMM E-Value=9.3e-41) 64 8e-11 SB_14524| Best HMM Match : DEAD (HMM E-Value=3.7e-17) 64 1e-10 SB_3952| Best HMM Match : No HMM Matches (HMM E-Value=.) 59 3e-09 SB_43842| Best HMM Match : RNB (HMM E-Value=0) 56 2e-08 SB_45898| Best HMM Match : DEAD (HMM E-Value=1.3e-36) 56 4e-08 SB_25090| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 4e-07 SB_5994| Best HMM Match : zf-CCHC (HMM E-Value=2.2e-19) 52 6e-07 SB_46680| Best HMM Match : Helicase_C (HMM E-Value=3.8e-22) 49 4e-06 SB_19958| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 7e-06 SB_30826| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.002 SB_52320| Best HMM Match : DEAD (HMM E-Value=0) 39 0.004 SB_51015| Best HMM Match : DEAD (HMM E-Value=0.0057) 37 0.018 SB_17563| Best HMM Match : DEAD (HMM E-Value=0) 35 0.054 SB_2247| Best HMM Match : DEAD (HMM E-Value=0) 35 0.054 SB_57459| Best HMM Match : DEAD (HMM E-Value=1.50001e-40) 35 0.071 SB_41683| Best HMM Match : DEAD (HMM E-Value=1.5e-27) 31 0.67 SB_26138| Best HMM Match : RhoGEF (HMM E-Value=0.0011) 31 0.67 SB_56998| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.88 SB_49218| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.2 SB_52637| Best HMM Match : Cpn60_TCP1 (HMM E-Value=0) 30 1.5 SB_14964| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.7 SB_32980| Best HMM Match : DEAD (HMM E-Value=0) 29 2.7 SB_11691| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.6 SB_3046| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.6 SB_15371| Best HMM Match : Keratin_B2 (HMM E-Value=1.2) 29 3.6 SB_6554| Best HMM Match : Isy1 (HMM E-Value=0) 29 3.6 SB_44832| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.7 SB_9558| Best HMM Match : DEAD (HMM E-Value=0) 29 4.7 SB_45527| Best HMM Match : DEAD (HMM E-Value=0.0069) 28 6.2 SB_13803| Best HMM Match : rve (HMM E-Value=8.6e-14) 28 6.2 SB_11337| Best HMM Match : Bim_N (HMM E-Value=0.45) 28 6.2 SB_8125| Best HMM Match : MFS_1 (HMM E-Value=3.2e-07) 28 6.2 SB_56471| Best HMM Match : RVT_1 (HMM E-Value=0.00041) 28 6.2 SB_52411| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.2 SB_34394| Best HMM Match : RVT_1 (HMM E-Value=8.7e-08) 28 6.2 SB_27735| Best HMM Match : Retrotrans_gag (HMM E-Value=0.097) 28 6.2 SB_27036| Best HMM Match : RVT_1 (HMM E-Value=0.00041) 28 6.2 SB_9739| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.2 SB_23248| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.2 >SB_16431| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 790 Score = 80.6 bits (190), Expect = 1e-15 Identities = 36/101 (35%), Positives = 57/101 (56%) Frame = +3 Query: 240 PXLGFVSLQPFNKNFYDPHPTVLKRSPYEVEEYRNKHEVTVSGVEVHNPIQYFEEANFPD 419 P + +PFNKNFY+ HP + K+S E+++ R K + VSG P F F + Sbjct: 467 PEKSKIDYKPFNKNFYEEHPEITKQSKQEIDDLRKKMGIKVSGAMPARPCISFAHFGFDE 526 Query: 420 YVQQGVKTMGYKEPTPIQAQGWPIAMSGKN*LA*PQTGSGQ 542 + ++ + Y +PT IQ Q PIA+SG++ + +TGSG+ Sbjct: 527 QMMASIRKLEYTQPTQIQCQALPIALSGRDIIGIAKTGSGK 567 Score = 56.0 bits (129), Expect = 3e-08 Identities = 26/48 (54%), Positives = 33/48 (68%) Frame = +1 Query: 541 KTLAYILPAIVHINNQPPIRRGDGPIALVLAXTRXLAQQIQQVAADFG 684 KT A++ PA+VHI +QP ++ GDGPI L+ A TR L QQI A FG Sbjct: 567 KTAAFLWPALVHIMDQPELQVGDGPIVLICAPTRELCQQIYTEARRFG 614 >SB_18993| Best HMM Match : DEAD (HMM E-Value=9.3e-41) Length = 690 Score = 64.5 bits (150), Expect = 8e-11 Identities = 29/46 (63%), Positives = 35/46 (76%) Frame = +1 Query: 553 YILPAIVHINNQPPIRRGDGPIALVLAXTRXLAQQIQQVAADFGTH 690 +ILP IVHIN+QP ++ GDGPI LVL TR LAQQ+Q+VA G H Sbjct: 113 FILPGIVHINHQPLLQPGDGPIVLVLCPTRELAQQVQEVAYSVGKH 158 Score = 60.5 bits (140), Expect = 1e-09 Identities = 27/56 (48%), Positives = 36/56 (64%) Frame = +3 Query: 312 RSPYEVEEYRNKHEVTVSGVEVHNPIQYFEEANFPDYVQQGVKTMGYKEPTPIQAQ 479 R +EV+ YR ++TV+G V P+ FEE+ FPDY+Q K G+ EPT IQAQ Sbjct: 57 RGQHEVDAYRRSKDLTVNGRNVPKPVTTFEESAFPDYIQSYFKREGFTEPTMIQAQ 112 >SB_14524| Best HMM Match : DEAD (HMM E-Value=3.7e-17) Length = 500 Score = 64.1 bits (149), Expect = 1e-10 Identities = 29/86 (33%), Positives = 49/86 (56%) Frame = +3 Query: 285 YDPHPTVLKRSPYEVEEYRNKHEVTVSGVEVHNPIQYFEEANFPDYVQQGVKTMGYKEPT 464 Y HPT+ + +V++ R+K E+ V G V +P+ F +F + + + + GY PT Sbjct: 161 YKEHPTIAALTAEQVKQLRDKMEIKVKGEHVVSPVLEFFHCSFNESLSKNLSNHGYHSPT 220 Query: 465 PIQAQGWPIAMSGKN*LA*PQTGSGQ 542 PIQ Q P+ +SG++ + TGSG+ Sbjct: 221 PIQMQVLPVLLSGRDVMVCASTGSGK 246 >SB_3952| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 592 Score = 59.3 bits (137), Expect = 3e-09 Identities = 31/89 (34%), Positives = 49/89 (55%), Gaps = 1/89 (1%) Frame = +3 Query: 255 VSLQPFNKNFYDPHPTVLKRSPYEVEEYRNKHE-VTVSGVEVHNPIQYFEEANFPDYVQQ 431 V QPF K+FY P + K +P E +E+R E + V G P++ + + + Sbjct: 59 VVYQPFRKDFYVEVPELAKMTPEETDEFRLSLENIHVRGKNAPKPVKTWAQTGVQLKILD 118 Query: 432 GVKTMGYKEPTPIQAQGWPIAMSGKN*LA 518 +K Y++PTPIQAQ P+ MSG++ +A Sbjct: 119 VLKKNSYEKPTPIQAQAIPVIMSGRDMIA 147 >SB_43842| Best HMM Match : RNB (HMM E-Value=0) Length = 1238 Score = 56.4 bits (130), Expect = 2e-08 Identities = 29/97 (29%), Positives = 50/97 (51%) Frame = +3 Query: 270 FNKNFYDPHPTVLKRSPYEVEEYRNKHEVTVSGVEVHNPIQYFEEANFPDYVQQGVKTMG 449 F ++YD + V + S V+E R K+ + + G + PI+ F + N P + + Sbjct: 32 FMWSYYDENEKVSRLSDEVVDEIRWKNGIHIEGEDCPKPIESFHDLNLPPELSTYLAKKN 91 Query: 450 YKEPTPIQAQGWPIAMSGKN*LA*PQTGSGQNVGLHL 560 ++ PTPIQ Q MSG++ + +TGSG+ + L Sbjct: 92 FQVPTPIQMQSLSCVMSGRDIIGLAETGSGKTLAYSL 128 Score = 41.9 bits (94), Expect = 5e-04 Identities = 19/40 (47%), Positives = 25/40 (62%) Frame = +1 Query: 541 KTLAYILPAIVHINNQPPIRRGDGPIALVLAXTRXLAQQI 660 KTLAY LP + + + P GD P+AL+L TR L QQ+ Sbjct: 122 KTLAYSLPLCMLLRTKAPSNPGDTPVALILTPTRELMQQV 161 >SB_45898| Best HMM Match : DEAD (HMM E-Value=1.3e-36) Length = 428 Score = 55.6 bits (128), Expect = 4e-08 Identities = 24/69 (34%), Positives = 41/69 (59%) Frame = +3 Query: 336 YRNKHEVTVSGVEVHNPIQYFEEANFPDYVQQGVKTMGYKEPTPIQAQGWPIAMSGKN*L 515 +R ++ G + PI+ ++EA PD + + V +GYK+PTPIQ Q PI + ++ + Sbjct: 83 FREDFNISTKGGRIPFPIRKWKEAQIPDSILEIVDKLGYKDPTPIQRQAIPIGLQNRDII 142 Query: 516 A*PQTGSGQ 542 +TGSG+ Sbjct: 143 GVAETGSGK 151 Score = 43.2 bits (97), Expect = 2e-04 Identities = 24/52 (46%), Positives = 31/52 (59%), Gaps = 4/52 (7%) Frame = +1 Query: 541 KTLAYILPAIVHINNQPPIRRGD----GPIALVLAXTRXLAQQIQQVAADFG 684 KT A+ +P +V I P I R + GP AL+LA TR LAQQI++ FG Sbjct: 151 KTAAFAIPLLVWIMGLPKIERDNDADQGPYALILAPTRELAQQIEEEILKFG 202 >SB_25090| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1170 Score = 52.0 bits (119), Expect = 4e-07 Identities = 30/77 (38%), Positives = 43/77 (55%) Frame = +3 Query: 330 EEYRNKHEVTVSGVEVHNPIQYFEEANFPDYVQQGVKTMGYKEPTPIQAQGWPIAMSGKN 509 E+Y ++ EV VSG I FEEAN + V+ YK+PTP+Q PI ++G++ Sbjct: 692 EKY-DQIEVLVSGNNPVRHINSFEEANLYEAFLNNVRKAQYKKPTPVQKYSIPIVIAGRD 750 Query: 510 *LA*PQTGSGQNVGLHL 560 +A QTGSG+ L Sbjct: 751 VMACAQTGSGKTAAFLL 767 >SB_5994| Best HMM Match : zf-CCHC (HMM E-Value=2.2e-19) Length = 185 Score = 51.6 bits (118), Expect = 6e-07 Identities = 29/71 (40%), Positives = 42/71 (59%) Frame = +3 Query: 330 EEYRNKHEVTVSGVEVHNPIQYFEEANFPDYVQQGVKTMGYKEPTPIQAQGWPIAMSGKN 509 E+Y ++ EV VSG I FEEAN + V+ YK+PTP+Q PI ++G++ Sbjct: 115 EKY-DQIEVLVSGNNPVRHINSFEEANLYEAFLNNVRKAQYKKPTPVQKYSIPIVIAGRD 173 Query: 510 *LA*PQTGSGQ 542 +A QTGSG+ Sbjct: 174 VMACAQTGSGK 184 >SB_46680| Best HMM Match : Helicase_C (HMM E-Value=3.8e-22) Length = 1058 Score = 48.8 bits (111), Expect = 4e-06 Identities = 22/64 (34%), Positives = 35/64 (54%), Gaps = 4/64 (6%) Frame = +3 Query: 324 EVEEYRNKHEVTVSGVEVHNPIQYF----EEANFPDYVQQGVKTMGYKEPTPIQAQGWPI 491 ++ +R++ + V G +V +P++ F E FPDY+ V+ GY PTPIQ Q P+ Sbjct: 137 KINLFRHEQHIYVKGADVPDPVETFSQLIERYGFPDYIIHNVQERGYTTPTPIQMQATPL 196 Query: 492 AMSG 503 G Sbjct: 197 MAHG 200 >SB_19958| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 797 Score = 48.0 bits (109), Expect = 7e-06 Identities = 24/67 (35%), Positives = 34/67 (50%) Frame = +3 Query: 360 VSGVEVHNPIQYFEEANFPDYVQQGVKTMGYKEPTPIQAQGWPIAMSGKN*LA*PQTGSG 539 VSG I F E F + + + GY+ PTP+Q PI M+G++ +A QTGSG Sbjct: 469 VSGENQPPKITSFNELPFGEQLMANISRAGYRRPTPVQKAALPIVMAGRDLMACAQTGSG 528 Query: 540 QNVGLHL 560 + L Sbjct: 529 KTAAYML 535 Score = 35.5 bits (78), Expect = 0.041 Identities = 20/50 (40%), Positives = 26/50 (52%) Frame = +1 Query: 541 KTLAYILPAIVHINNQPPIRRGDGPIALVLAXTRXLAQQIQQVAADFGTH 690 KT AY+LP + + Q P+AL +A TR LA+QI A F H Sbjct: 529 KTAAYMLPVLTSLIKQGLNAPPRSPLALCVAPTRELAKQIYIEARKFSDH 578 >SB_30826| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1375 Score = 39.9 bits (89), Expect = 0.002 Identities = 19/52 (36%), Positives = 29/52 (55%) Frame = +3 Query: 387 IQYFEEANFPDYVQQGVKTMGYKEPTPIQAQGWPIAMSGKN*LA*PQTGSGQ 542 I FE+ + + + V GYK+PTP+Q PI ++ +A QTGSG+ Sbjct: 874 ILQFEDVDLGEILLHNVGLAGYKKPTPVQKYAIPIVKGKRDLMACAQTGSGK 925 >SB_52320| Best HMM Match : DEAD (HMM E-Value=0) Length = 340 Score = 38.7 bits (86), Expect = 0.004 Identities = 18/54 (33%), Positives = 30/54 (55%) Frame = +3 Query: 387 IQYFEEANFPDYVQQGVKTMGYKEPTPIQAQGWPIAMSGKN*LA*PQTGSGQNV 548 ++ F + G+ G+ PT IQ QG P+A+SG++ L +TGSG+ + Sbjct: 49 VEKFSDFPISKRTLDGLMKAGFVTPTDIQKQGIPVALSGRDVLGAAKTGSGKTL 102 >SB_51015| Best HMM Match : DEAD (HMM E-Value=0.0057) Length = 96 Score = 36.7 bits (81), Expect = 0.018 Identities = 17/44 (38%), Positives = 25/44 (56%) Frame = +3 Query: 429 QGVKTMGYKEPTPIQAQGWPIAMSGKN*LA*PQTGSGQNVGLHL 560 + V +G+ PTPIQA P+A+ GK+ A TG+G+ L Sbjct: 23 RAVNELGFLHPTPIQASTIPVALMGKDVCACAATGTGKTAAFML 66 >SB_17563| Best HMM Match : DEAD (HMM E-Value=0) Length = 439 Score = 35.1 bits (77), Expect = 0.054 Identities = 15/49 (30%), Positives = 30/49 (61%) Frame = +3 Query: 396 FEEANFPDYVQQGVKTMGYKEPTPIQAQGWPIAMSGKN*LA*PQTGSGQ 542 FE+ + G+ G+ +P+PIQ + P+A++G++ LA + G+G+ Sbjct: 49 FEDYCLKRELLMGIFEKGFDKPSPIQEESIPVALAGRDILARAKNGTGK 97 Score = 27.9 bits (59), Expect = 8.2 Identities = 17/50 (34%), Positives = 24/50 (48%) Frame = +1 Query: 541 KTLAYILPAIVHINNQPPIRRGDGPIALVLAXTRXLAQQIQQVAADFGTH 690 KT AY++P + + + ALVL TR LA Q Q+ + G H Sbjct: 97 KTAAYLVPLLERTDTTKNCIQ-----ALVLVPTRELALQTSQICIELGKH 141 >SB_2247| Best HMM Match : DEAD (HMM E-Value=0) Length = 439 Score = 35.1 bits (77), Expect = 0.054 Identities = 15/49 (30%), Positives = 30/49 (61%) Frame = +3 Query: 396 FEEANFPDYVQQGVKTMGYKEPTPIQAQGWPIAMSGKN*LA*PQTGSGQ 542 FE+ + G+ G+ +P+PIQ + P+A++G++ LA + G+G+ Sbjct: 49 FEDYCLKRELLMGIFEKGFDKPSPIQEESIPVALAGRDILARAKNGTGK 97 Score = 27.9 bits (59), Expect = 8.2 Identities = 17/50 (34%), Positives = 24/50 (48%) Frame = +1 Query: 541 KTLAYILPAIVHINNQPPIRRGDGPIALVLAXTRXLAQQIQQVAADFGTH 690 KT AY++P + + + ALVL TR LA Q Q+ + G H Sbjct: 97 KTAAYLVPLLERTDTTKNCIQ-----ALVLVPTRELALQTSQICIELGKH 141 >SB_57459| Best HMM Match : DEAD (HMM E-Value=1.50001e-40) Length = 490 Score = 34.7 bits (76), Expect = 0.071 Identities = 23/77 (29%), Positives = 40/77 (51%), Gaps = 5/77 (6%) Frame = +3 Query: 345 KHEVTVSGVEVHNPI---QYFEEANFPDYVQQGVKTMGYKEPTPIQAQGWPIAMSGK--N 509 KHEV V + +P+ + FEE +++GV MG+ +P+ IQ P+ ++ N Sbjct: 85 KHEVEVLRSDPSSPLYSAKSFEELPLSANLRRGVYDMGFNKPSKIQETALPMLLADPPVN 144 Query: 510 *LA*PQTGSGQNVGLHL 560 +A Q+G+G+ L Sbjct: 145 MIAQSQSGTGKTAAFVL 161 >SB_41683| Best HMM Match : DEAD (HMM E-Value=1.5e-27) Length = 559 Score = 31.5 bits (68), Expect = 0.67 Identities = 18/51 (35%), Positives = 29/51 (56%) Frame = +3 Query: 414 PDYVQQGVKTMGYKEPTPIQAQGWPIAMSGKN*LA*PQTGSGQNVGLHLAS 566 P V++ +K MG +P PIQ + P S K+ L +TG+G+++ L S Sbjct: 169 PKLVEK-LKKMGITKPVPIQEKALPSVFSHKSLLIKSETGTGKSLVFLLPS 218 >SB_26138| Best HMM Match : RhoGEF (HMM E-Value=0.0011) Length = 1199 Score = 31.5 bits (68), Expect = 0.67 Identities = 14/30 (46%), Positives = 18/30 (60%) Frame = +1 Query: 226 QNMRRPXWDSFHSNLSTKTFMIHILQFSKD 315 +N RR WDSFHSN+S + H+ F D Sbjct: 768 RNKRR--WDSFHSNVSADSGSAHMFDFDTD 795 >SB_56998| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 478 Score = 31.1 bits (67), Expect = 0.88 Identities = 20/51 (39%), Positives = 27/51 (52%), Gaps = 1/51 (1%) Frame = +1 Query: 541 KTLAYILPAIVHINNQPPIRRG-DGPIALVLAXTRXLAQQIQQVAADFGTH 690 KT + + + I+ + G D ALVLA TR LAQQIQ+V G + Sbjct: 135 KTATFAISILQEIDTNYKDKNGCDCCQALVLAPTRELAQQIQKVVLALGDY 185 >SB_49218| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 480 Score = 30.7 bits (66), Expect = 1.2 Identities = 11/38 (28%), Positives = 17/38 (44%) Frame = +3 Query: 372 EVHNPIQYFEEANFPDYVQQGVKTMGYKEPTPIQAQGW 485 ++H P++ + FP Y + Y P P QA W Sbjct: 6 DIHGPVRKLHKHGFPGYEEDYAAVFKYPTPWPEQAMEW 43 >SB_52637| Best HMM Match : Cpn60_TCP1 (HMM E-Value=0) Length = 505 Score = 30.3 bits (65), Expect = 1.5 Identities = 14/44 (31%), Positives = 26/44 (59%) Frame = +3 Query: 318 PYEVEEYRNKHEVTVSGVEVHNPIQYFEEANFPDYVQQGVKTMG 449 P+E + + KH++ V+ VE + +Q +E F + ++Q VK G Sbjct: 252 PFEPPKPKTKHKLDVATVEDYKKLQEYEREKFTEMIKQ-VKDTG 294 >SB_14964| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1149 Score = 29.5 bits (63), Expect = 2.7 Identities = 21/75 (28%), Positives = 38/75 (50%), Gaps = 1/75 (1%) Frame = -2 Query: 222 SREXFXPTKASRSSKSIATVAKPRRIIAEFVASSKFG-TTVSTAIIPVTRHDYFSDLVED 46 SRE P + + ++ + + ++ A+ A+S G +T S +++ Y S V D Sbjct: 398 SREELQPIRPNLTAANNSPISIEGAFFAKLSATSYNGQSTTSFSMV------YVSSSVRD 451 Query: 45 VYLNYGFFLTQGLVP 1 +YL+YG L L+P Sbjct: 452 MYLSYGSLLNLDLLP 466 >SB_32980| Best HMM Match : DEAD (HMM E-Value=0) Length = 985 Score = 29.5 bits (63), Expect = 2.7 Identities = 11/38 (28%), Positives = 25/38 (65%) Frame = +3 Query: 429 QGVKTMGYKEPTPIQAQGWPIAMSGKN*LA*PQTGSGQ 542 +G+ G+++P+PIQ + P+ G + +A ++G+G+ Sbjct: 26 RGLNEAGFEKPSPIQLKAIPLGRCGLDLIAQAKSGTGK 63 >SB_11691| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1448 Score = 29.1 bits (62), Expect = 3.6 Identities = 14/40 (35%), Positives = 23/40 (57%) Frame = +3 Query: 429 QGVKTMGYKEPTPIQAQGWPIAMSGKN*LA*PQTGSGQNV 548 QG+K MG+ T IQ + + G++ L +TGSG+ + Sbjct: 585 QGIKDMGFTTMTEIQHKSIAPLLKGRDLLGAAKTGSGKTL 624 >SB_3046| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 734 Score = 29.1 bits (62), Expect = 3.6 Identities = 13/37 (35%), Positives = 20/37 (54%) Frame = -1 Query: 202 HQSLQILQIYCHRCQTETNYRRICCLLQIWNHRFHGY 92 H L YC RC T CCLLQ++++ ++G+ Sbjct: 484 HLQQPSLAAYC-RCITILTTAIACCLLQVYHNTYNGH 519 >SB_15371| Best HMM Match : Keratin_B2 (HMM E-Value=1.2) Length = 223 Score = 29.1 bits (62), Expect = 3.6 Identities = 21/75 (28%), Positives = 37/75 (49%), Gaps = 1/75 (1%) Frame = -2 Query: 222 SREXFXPTKASRSSKSIATVAKPRRIIAEFVASSKFG-TTVSTAIIPVTRHDYFSDLVED 46 SRE P + S ++ + + ++ A+ A+S G +T S +++ Y S V D Sbjct: 42 SREELQPIRPSLTAANNSPISIEGAFFAKLSATSYSGQSTTSFSMV------YVSSSVRD 95 Query: 45 VYLNYGFFLTQGLVP 1 +YL+Y L L+P Sbjct: 96 IYLSYDSLLNLDLLP 110 >SB_6554| Best HMM Match : Isy1 (HMM E-Value=0) Length = 675 Score = 29.1 bits (62), Expect = 3.6 Identities = 13/32 (40%), Positives = 20/32 (62%), Gaps = 1/32 (3%) Frame = +3 Query: 330 EEYRNK-HEVTVSGVEVHNPIQYFEEANFPDY 422 EE NK H++ + + +HNP YFE+ + DY Sbjct: 234 EEVNNKLHKILIVNM-IHNPFNYFEKKSPTDY 264 >SB_44832| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 292 Score = 28.7 bits (61), Expect = 4.7 Identities = 11/19 (57%), Positives = 14/19 (73%) Frame = -1 Query: 277 LLKGWSETNPNXGVACSAL 221 LLKGW TN N +AC+A+ Sbjct: 150 LLKGWGATNFNHAMACAAV 168 >SB_9558| Best HMM Match : DEAD (HMM E-Value=0) Length = 436 Score = 28.7 bits (61), Expect = 4.7 Identities = 14/39 (35%), Positives = 21/39 (53%) Frame = +3 Query: 444 MGYKEPTPIQAQGWPIAMSGKN*LA*PQTGSGQNVGLHL 560 MG K+PT IQ P + G++ + +TGSG+ L Sbjct: 25 MGIKKPTEIQLNCVPPILQGRDCIGCAKTGSGKTAAFAL 63 >SB_45527| Best HMM Match : DEAD (HMM E-Value=0.0069) Length = 120 Score = 28.3 bits (60), Expect = 6.2 Identities = 14/26 (53%), Positives = 17/26 (65%) Frame = +1 Query: 613 PIALVLAXTRXLAQQIQQVAADFGTH 690 P ALVL+ TR LA QIQ+V G + Sbjct: 4 PQALVLSPTRELANQIQKVVLALGDY 29 >SB_13803| Best HMM Match : rve (HMM E-Value=8.6e-14) Length = 1447 Score = 28.3 bits (60), Expect = 6.2 Identities = 21/75 (28%), Positives = 37/75 (49%), Gaps = 1/75 (1%) Frame = -2 Query: 222 SREXFXPTKASRSSKSIATVAKPRRIIAEFVASSKFG-TTVSTAIIPVTRHDYFSDLVED 46 SRE P + S ++ + + ++ A+ A+S G +T S +++ Y S V D Sbjct: 393 SREELQPIRPSLTAANNSPISIEGAFFAKLSATSYSGQSTTSFSMV------YVSSSVRD 446 Query: 45 VYLNYGFFLTQGLVP 1 +YL+Y L L+P Sbjct: 447 MYLSYDSLLNLDLLP 461 >SB_11337| Best HMM Match : Bim_N (HMM E-Value=0.45) Length = 286 Score = 28.3 bits (60), Expect = 6.2 Identities = 21/75 (28%), Positives = 37/75 (49%), Gaps = 1/75 (1%) Frame = -2 Query: 222 SREXFXPTKASRSSKSIATVAKPRRIIAEFVASSKFG-TTVSTAIIPVTRHDYFSDLVED 46 SRE P + S ++ + + ++ A+ A+S G +T S +++ Y S V D Sbjct: 159 SREELQPIRPSLTAANNSPISIEGAFFAKLSATSYSGQSTTSFSMV------YVSSSVRD 212 Query: 45 VYLNYGFFLTQGLVP 1 +YL+Y L L+P Sbjct: 213 MYLSYDSLLNLDLLP 227 >SB_8125| Best HMM Match : MFS_1 (HMM E-Value=3.2e-07) Length = 401 Score = 28.3 bits (60), Expect = 6.2 Identities = 16/49 (32%), Positives = 24/49 (48%), Gaps = 1/49 (2%) Frame = -1 Query: 226 ALQRIXXSHQSLQILQIYCHRCQTETNYRRICCLLQIWN-HRFHGYYSS 83 AL+RI + ++ C +YRR CC L +W H + Y+SS Sbjct: 197 ALERIATPVTTSKLRCSTTQECCVRVDYRRKCC-LHVWRVHTTNTYWSS 244 >SB_56471| Best HMM Match : RVT_1 (HMM E-Value=0.00041) Length = 1155 Score = 28.3 bits (60), Expect = 6.2 Identities = 21/75 (28%), Positives = 37/75 (49%), Gaps = 1/75 (1%) Frame = -2 Query: 222 SREXFXPTKASRSSKSIATVAKPRRIIAEFVASSKFG-TTVSTAIIPVTRHDYFSDLVED 46 SRE P + S ++ + + ++ A+ A+S G +T S +++ Y S V D Sbjct: 159 SREELQPIRPSLTAANNSPISIEGAFFAKLSATSYSGQSTTSFSMV------YVSSSVRD 212 Query: 45 VYLNYGFFLTQGLVP 1 +YL+Y L L+P Sbjct: 213 MYLSYDSLLNLDLLP 227 >SB_52411| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 370 Score = 28.3 bits (60), Expect = 6.2 Identities = 14/26 (53%), Positives = 17/26 (65%) Frame = +1 Query: 613 PIALVLAXTRXLAQQIQQVAADFGTH 690 P ALVL+ TR LA QIQ+V G + Sbjct: 66 PQALVLSPTRELANQIQKVVLALGDY 91 >SB_34394| Best HMM Match : RVT_1 (HMM E-Value=8.7e-08) Length = 1201 Score = 28.3 bits (60), Expect = 6.2 Identities = 21/75 (28%), Positives = 37/75 (49%), Gaps = 1/75 (1%) Frame = -2 Query: 222 SREXFXPTKASRSSKSIATVAKPRRIIAEFVASSKFG-TTVSTAIIPVTRHDYFSDLVED 46 SRE P + S ++ + + ++ A+ A+S G +T S +++ Y S V D Sbjct: 425 SREELQPIRPSLTAANNSPISIEGAFFAKLSATSYSGQSTTSFSMV------YVSSSVRD 478 Query: 45 VYLNYGFFLTQGLVP 1 +YL+Y L L+P Sbjct: 479 MYLSYDSLLNLDLLP 493 >SB_27735| Best HMM Match : Retrotrans_gag (HMM E-Value=0.097) Length = 812 Score = 28.3 bits (60), Expect = 6.2 Identities = 21/75 (28%), Positives = 37/75 (49%), Gaps = 1/75 (1%) Frame = -2 Query: 222 SREXFXPTKASRSSKSIATVAKPRRIIAEFVASSKFG-TTVSTAIIPVTRHDYFSDLVED 46 SRE P + S ++ + + ++ A+ A+S G +T S +++ Y S V D Sbjct: 483 SREELQPIRPSLTAANNSPISIEGAFFAKLSATSYSGQSTTSFSMV------YVSSSVRD 536 Query: 45 VYLNYGFFLTQGLVP 1 +YL+Y L L+P Sbjct: 537 MYLSYDSLLNLDLLP 551 >SB_27036| Best HMM Match : RVT_1 (HMM E-Value=0.00041) Length = 1059 Score = 28.3 bits (60), Expect = 6.2 Identities = 21/75 (28%), Positives = 37/75 (49%), Gaps = 1/75 (1%) Frame = -2 Query: 222 SREXFXPTKASRSSKSIATVAKPRRIIAEFVASSKFG-TTVSTAIIPVTRHDYFSDLVED 46 SRE P + S ++ + + ++ A+ A+S G +T S +++ Y S V D Sbjct: 360 SREELQPIRPSLTAANNSPISIEGAFFAKLSATSYSGQSTTSFSMV------YVSSSVRD 413 Query: 45 VYLNYGFFLTQGLVP 1 +YL+Y L L+P Sbjct: 414 MYLSYDSLLNLDLLP 428 >SB_9739| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1552 Score = 28.3 bits (60), Expect = 6.2 Identities = 21/75 (28%), Positives = 37/75 (49%), Gaps = 1/75 (1%) Frame = -2 Query: 222 SREXFXPTKASRSSKSIATVAKPRRIIAEFVASSKFG-TTVSTAIIPVTRHDYFSDLVED 46 SRE P + S ++ + + ++ A+ A+S G +T S +++ Y S V D Sbjct: 406 SREELQPIRPSLTAANNSPISIEGAFFAKLSATSYSGQSTTSFSMV------YVSSSVRD 459 Query: 45 VYLNYGFFLTQGLVP 1 +YL+Y L L+P Sbjct: 460 MYLSYDSLLNLDLLP 474 >SB_23248| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 29 Score = 27.9 bits (59), Expect = 8.2 Identities = 11/18 (61%), Positives = 15/18 (83%) Frame = -2 Query: 267 VGVKRIPXWASHVLPSRE 214 VGV+ I WAS++LPSR+ Sbjct: 10 VGVRDIEQWASNLLPSRQ 27 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 19,707,533 Number of Sequences: 59808 Number of extensions: 404413 Number of successful extensions: 977 Number of sequences better than 10.0: 40 Number of HSP's better than 10.0 without gapping: 919 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 976 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1793485733 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -