BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV060965.seq (691 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ288391-1|ABC41341.1| 630|Apis mellifera vasa protein protein. 61 8e-12 AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein. 24 1.2 DQ869053-1|ABJ09600.1| 459|Apis mellifera capa-like receptor pr... 21 8.4 AY921573-1|AAX62923.1| 694|Apis mellifera D2-like dopamine rece... 21 8.4 AF000632-1|AAC61894.1| 452|Apis mellifera major royal jelly pro... 21 8.4 >DQ288391-1|ABC41341.1| 630|Apis mellifera vasa protein protein. Length = 630 Score = 61.3 bits (142), Expect = 8e-12 Identities = 29/64 (45%), Positives = 40/64 (62%) Frame = +3 Query: 351 EVTVSGVEVHNPIQYFEEANFPDYVQQGVKTMGYKEPTPIQAQGWPIAMSGKN*LA*PQT 530 +V VSG V PI+ FE A + V +K GYK+PTP+Q PI M+G++ +A QT Sbjct: 183 QVNVSGDNVPQPIESFEAAGLRNIVLDNIKKSGYKKPTPVQKHALPIIMNGRDLMACAQT 242 Query: 531 GSGQ 542 GSG+ Sbjct: 243 GSGK 246 >AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein. Length = 1598 Score = 24.2 bits (50), Expect = 1.2 Identities = 13/42 (30%), Positives = 21/42 (50%) Frame = +1 Query: 508 ISWRSHKRVPVKTLAYILPAIVHINNQPPIRRGDGPIALVLA 633 IS +++P++ A I P + + P R GP+A V A Sbjct: 527 ISLLEQQKIPLRMTAGIDPKSIFNSGYRPKPRMSGPVAAVAA 568 >DQ869053-1|ABJ09600.1| 459|Apis mellifera capa-like receptor protein. Length = 459 Score = 21.4 bits (43), Expect = 8.4 Identities = 10/24 (41%), Positives = 13/24 (54%) Frame = -2 Query: 633 RQDQSNRTITSPNRRLVIYVHNCW 562 +Q QS +TIT +VI CW Sbjct: 250 KQVQSRKTITRMLSAVVITFFICW 273 >AY921573-1|AAX62923.1| 694|Apis mellifera D2-like dopamine receptor protein. Length = 694 Score = 21.4 bits (43), Expect = 8.4 Identities = 9/20 (45%), Positives = 12/20 (60%) Frame = +2 Query: 83 TGIIAVETVVPNLEEATNSA 142 T + A V P +EE TN+A Sbjct: 412 TALGAAALVAPGMEEPTNTA 431 >AF000632-1|AAC61894.1| 452|Apis mellifera major royal jelly protein MRJP2 protein. Length = 452 Score = 21.4 bits (43), Expect = 8.4 Identities = 7/18 (38%), Positives = 14/18 (77%) Frame = +3 Query: 309 KRSPYEVEEYRNKHEVTV 362 K P++V+++R+K VT+ Sbjct: 64 KNYPFDVDQWRDKTFVTI 81 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 174,718 Number of Sequences: 438 Number of extensions: 3749 Number of successful extensions: 11 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 11 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 11 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 21073995 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -