BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV060962.seq (728 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value DQ659249-1|ABG47447.1| 383|Tribolium castaneum chitinase 9 prot... 23 2.5 AY873915-1|AAW67571.2| 384|Tribolium castaneum chitinase 16 pro... 23 2.5 AY873914-1|AAW67570.1| 384|Tribolium castaneum chitinase 3 prot... 23 2.5 AF442747-1|AAL40947.1| 669|Tribolium castaneum ABC transmembran... 23 3.3 AF422804-1|AAL56571.1| 669|Tribolium castaneum ABC transmembran... 23 3.3 AM292349-1|CAL23161.1| 248|Tribolium castaneum gustatory recept... 22 4.4 X91618-1|CAA62821.1| 524|Tribolium castaneum hunchback protein. 21 7.7 AF217810-1|AAF71998.1| 431|Tribolium castaneum fork head orthol... 21 7.7 >DQ659249-1|ABG47447.1| 383|Tribolium castaneum chitinase 9 protein. Length = 383 Score = 23.0 bits (47), Expect = 2.5 Identities = 7/13 (53%), Positives = 10/13 (76%) Frame = -2 Query: 514 IGYNHIQHLFSEW 476 IGYN + L+S+W Sbjct: 298 IGYNEVCELYSDW 310 >AY873915-1|AAW67571.2| 384|Tribolium castaneum chitinase 16 protein. Length = 384 Score = 23.0 bits (47), Expect = 2.5 Identities = 7/13 (53%), Positives = 10/13 (76%) Frame = -2 Query: 514 IGYNHIQHLFSEW 476 IGYN + L+S+W Sbjct: 299 IGYNEVCELYSDW 311 >AY873914-1|AAW67570.1| 384|Tribolium castaneum chitinase 3 protein. Length = 384 Score = 23.0 bits (47), Expect = 2.5 Identities = 7/13 (53%), Positives = 10/13 (76%) Frame = -2 Query: 514 IGYNHIQHLFSEW 476 IGYN + L+S+W Sbjct: 299 IGYNEVCELYSDW 311 >AF442747-1|AAL40947.1| 669|Tribolium castaneum ABC transmembrane transporter protein. Length = 669 Score = 22.6 bits (46), Expect = 3.3 Identities = 10/33 (30%), Positives = 19/33 (57%) Frame = +1 Query: 253 HASEPDYILKKGDLAKIDLGAHIDGFIAVVAHT 351 H SE D+++ LA + +G + F+A++ T Sbjct: 633 HFSEADFVMDVVMLAVLIVGFRLVAFLALLVKT 665 >AF422804-1|AAL56571.1| 669|Tribolium castaneum ABC transmembrane transporter white protein. Length = 669 Score = 22.6 bits (46), Expect = 3.3 Identities = 10/33 (30%), Positives = 19/33 (57%) Frame = +1 Query: 253 HASEPDYILKKGDLAKIDLGAHIDGFIAVVAHT 351 H SE D+++ LA + +G + F+A++ T Sbjct: 633 HFSEADFVMDVVMLAVLIVGFRLVAFLALLVKT 665 >AM292349-1|CAL23161.1| 248|Tribolium castaneum gustatory receptor candidate 28 protein. Length = 248 Score = 22.2 bits (45), Expect = 4.4 Identities = 9/28 (32%), Positives = 13/28 (46%) Frame = +3 Query: 195 KALHFQHAFL*TTAFVTFRPCERTGLHS 278 K +H AF+T + CE L+S Sbjct: 190 KVFPVEHLLFIANAFITSQSCENATLYS 217 >X91618-1|CAA62821.1| 524|Tribolium castaneum hunchback protein. Length = 524 Score = 21.4 bits (43), Expect = 7.7 Identities = 7/28 (25%), Positives = 14/28 (50%) Frame = +1 Query: 196 RHCIFNMRFCEQLHLSLFAHASEPDYIL 279 R C + ++C L + L + P+ +L Sbjct: 290 RDCSYATKYCHSLKIHLRRYGHTPNVVL 317 >AF217810-1|AAF71998.1| 431|Tribolium castaneum fork head orthologue protein. Length = 431 Score = 21.4 bits (43), Expect = 7.7 Identities = 7/18 (38%), Positives = 12/18 (66%) Frame = +1 Query: 580 IHQKHSVKNMKKQHLKSM 633 +HQ+H +NM + L +M Sbjct: 313 MHQQHHQQNMSHEELSAM 330 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 169,483 Number of Sequences: 336 Number of extensions: 3418 Number of successful extensions: 12 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 12 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 12 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 19467635 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -