BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV060864.seq (673 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 02_05_1278 - 35416451-35416458,35416777-35416969,35416970-354170... 29 3.4 08_01_0461 - 4063614-4064375,4064439-4066017,4066041-4066086,406... 28 7.8 >02_05_1278 - 35416451-35416458,35416777-35416969,35416970-35417056, 35417851-35417892,35418542-35418617,35418954-35421589 Length = 1013 Score = 29.1 bits (62), Expect = 3.4 Identities = 12/31 (38%), Positives = 20/31 (64%) Frame = -1 Query: 373 PGSVLSNVVLIQSVRCILIHLHLNVNVNTHL 281 PG LSN +L ++ I +H+ L V++NT + Sbjct: 958 PGHCLSNEILKMVIKPIFVHVLLQVHMNTEV 988 >08_01_0461 - 4063614-4064375,4064439-4066017,4066041-4066086, 4066416-4066933,4067435-4067694,4068089-4068594, 4068667-4071319 Length = 2107 Score = 27.9 bits (59), Expect = 7.8 Identities = 15/38 (39%), Positives = 21/38 (55%) Frame = +1 Query: 172 RCKGNFILVRSEIKLATRHSLLQLTTTLDDKHYYVYLD 285 RCKG +I + S K SLL+L + L + Y Y+D Sbjct: 463 RCKGRYIPLASLTKRLGAKSLLKLKSNLLLETAYAYMD 500 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,467,085 Number of Sequences: 37544 Number of extensions: 239836 Number of successful extensions: 348 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 344 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 348 length of database: 14,793,348 effective HSP length: 79 effective length of database: 11,827,372 effective search space used: 1703141568 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -