BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV060862.seq (658 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g16680.1 68418.m01951 PHD finger family protein contains Pfam... 32 0.29 At5g54260.1 68418.m06759 DNA repair and meiosis protein (Mre11) ... 30 1.2 At2g24370.1 68415.m02912 protein kinase family protein contains ... 29 3.6 At1g79200.1 68414.m09234 expressed protein 28 6.3 At5g04360.1 68418.m00428 pullulanase, putative / starch debranch... 27 8.3 At4g31110.1 68417.m04415 wall-associated kinase, putative simila... 27 8.3 At3g54760.1 68416.m06059 dentin sialophosphoprotein-related cont... 27 8.3 >At5g16680.1 68418.m01951 PHD finger family protein contains Pfam domain, PF00628: PHD-finger Length = 1290 Score = 32.3 bits (70), Expect = 0.29 Identities = 21/59 (35%), Positives = 31/59 (52%), Gaps = 1/59 (1%) Frame = +1 Query: 280 SRSDDIGTQ-YTNPNTKRHGFFANESQDSKHFESSRPRSFKARKEPTGERSNRSDSPRK 453 SR D++ + NP++ ++E + K E SRP K R+EP+ E S RS RK Sbjct: 197 SRKDEVKLESLQNPSSNHDDRVSSEKGNFK--EKSRPGGNKERQEPSVEGSTRSGENRK 253 >At5g54260.1 68418.m06759 DNA repair and meiosis protein (Mre11) identical to DNA repair and meiosis protein (Mre11) GI:5524769 from [Arabidopsis thaliana] Length = 720 Score = 30.3 bits (65), Expect = 1.2 Identities = 14/38 (36%), Positives = 24/38 (63%), Gaps = 1/38 (2%) Frame = +2 Query: 314 IQTPKD-MVFSQTSLKTRNILKVVDLDRLKPEKNQQAN 424 + P+D ++FS+ S K R+ + D +RL+PE+ Q N Sbjct: 388 VANPQDILIFSKASKKGRSEANIDDSERLRPEELNQQN 425 >At2g24370.1 68415.m02912 protein kinase family protein contains protein kinase domain, Pfam:PF00069 Length = 816 Score = 28.7 bits (61), Expect = 3.6 Identities = 12/31 (38%), Positives = 18/31 (58%) Frame = +1 Query: 508 LKPEQLYASTMLHGSNSEFFQELXQLCSDPE 600 L+P L S LH S+++ Q+ +C DPE Sbjct: 55 LRPSPLNNSASLHASSAKLSQDSSLVCRDPE 85 >At1g79200.1 68414.m09234 expressed protein Length = 159 Score = 27.9 bits (59), Expect = 6.3 Identities = 16/60 (26%), Positives = 30/60 (50%), Gaps = 1/60 (1%) Frame = +1 Query: 280 SRSDDIGTQYTNPNTKRH-GFFANESQDSKHFESSRPRSFKARKEPTGERSNRSDSPRKQ 456 +RS+D + KRH G ++ + S+ + +S K K T ++S + D P+K+ Sbjct: 15 ARSEDSSSSDYEEKVKRHRGTEKDDERRSRRSDKKDKKSHKHHKSSTSKKS-KDDKPKKK 73 >At5g04360.1 68418.m00428 pullulanase, putative / starch debranching enzyme, putative similar to pullulanase [Spinacia oleracea] GI:634093 (EC 3.2.1.41); contains Pfam profiles PF00128: Alpha amylase catalytic domain, PF02922: Isoamylase N-terminal domain Length = 965 Score = 27.5 bits (58), Expect = 8.3 Identities = 22/57 (38%), Positives = 28/57 (49%), Gaps = 8/57 (14%) Frame = +2 Query: 512 NRNSYTRAQCFTVRTQS-SSKNWXSCAPIQKGKNKHG-PLILIK------KPKNGHV 658 +R+SY F S SS NW P KGKN+H PLI + KPK+ H+ Sbjct: 775 DRDSYNSGDWFNRLDFSYSSNNWGVGLP-PKGKNEHNWPLIKPRLQDPSFKPKSSHI 830 >At4g31110.1 68417.m04415 wall-associated kinase, putative similar to wall-associated kinase 1, Arabidopsis thaliana, gb:AJ009696 Length = 756 Score = 27.5 bits (58), Expect = 8.3 Identities = 11/30 (36%), Positives = 17/30 (56%) Frame = +1 Query: 559 EFFQELXQLCSDPEREEQTRTIDSHKETEK 648 E F EL ++C+ PE + ID +E E+ Sbjct: 683 EVFTELERICTSPEDSQVHNRIDEEEEEEE 712 >At3g54760.1 68416.m06059 dentin sialophosphoprotein-related contains weak similarity to Swiss-Prot:Q9NZW4 dentin sialophosphoprotein precursor (Dentin phosphophoryn DPP, Dentin sialoprotein DSP) [Homo sapiens] Length = 792 Score = 27.5 bits (58), Expect = 8.3 Identities = 13/35 (37%), Positives = 22/35 (62%), Gaps = 2/35 (5%) Frame = +1 Query: 346 NESQDSKHFESSR--PRSFKARKEPTGERSNRSDS 444 NE++D+KH ES++ S K KE T E + + ++ Sbjct: 193 NETEDAKHSESAQVPEESTKLSKEETDEENQKEEN 227 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,088,178 Number of Sequences: 28952 Number of extensions: 255141 Number of successful extensions: 798 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 785 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 798 length of database: 12,070,560 effective HSP length: 78 effective length of database: 9,812,304 effective search space used: 1373722560 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -