BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV060852.seq (684 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value DQ137802-1|AAZ78363.1| 265|Anopheles gambiae female-specific do... 27 0.42 AY903308-1|AAX48940.1| 241|Anopheles gambiae female-specific do... 27 0.42 AB090816-2|BAC57908.1| 1201|Anopheles gambiae reverse transcript... 26 1.3 AJ441131-3|CAD29632.1| 568|Anopheles gambiae putative apyrase/n... 25 2.2 AJ439398-2|CAD28125.1| 568|Anopheles gambiae putative 5' nucleo... 25 2.2 AY578808-1|AAT07313.1| 458|Anopheles gambiae saxophone protein. 25 2.9 AY753540-1|AAV28543.1| 3320|Anopheles gambiae SGS3 protein. 24 3.9 AY753539-1|AAV28542.1| 3318|Anopheles gambiae SGS2 protein. 24 3.9 >DQ137802-1|AAZ78363.1| 265|Anopheles gambiae female-specific doublesex protein protein. Length = 265 Score = 27.5 bits (58), Expect = 0.42 Identities = 11/36 (30%), Positives = 21/36 (58%) Frame = -3 Query: 259 HRTLHDSAAFMSQYYRKHSLRIFSGECIRVSMADSG 152 H+ + + A +++Y R H+L +F G +R + SG Sbjct: 230 HQRIDEGQAVVNEYSRLHNLNMFDGVELRNTTRQSG 265 >AY903308-1|AAX48940.1| 241|Anopheles gambiae female-specific doublesex protein protein. Length = 241 Score = 27.5 bits (58), Expect = 0.42 Identities = 11/36 (30%), Positives = 21/36 (58%) Frame = -3 Query: 259 HRTLHDSAAFMSQYYRKHSLRIFSGECIRVSMADSG 152 H+ + + A +++Y R H+L +F G +R + SG Sbjct: 206 HQRIDEGQAVVNEYSRLHNLNMFDGVELRNTTRQSG 241 >AB090816-2|BAC57908.1| 1201|Anopheles gambiae reverse transcriptase protein. Length = 1201 Score = 25.8 bits (54), Expect = 1.3 Identities = 15/49 (30%), Positives = 26/49 (53%), Gaps = 2/49 (4%) Frame = +3 Query: 69 GKQASRCPSRRLKWTR--QKPVKCALRSRPPESAILTRIHSPEKILREC 209 G+Q RC SRR K T+ ++ + ALR+ + ++ I E ++ C Sbjct: 297 GRQHDRCDSRRWKTTQFNRQSFRVALRANNFQERAVSHIGMIEALVDAC 345 >AJ441131-3|CAD29632.1| 568|Anopheles gambiae putative apyrase/nucleotidase protein. Length = 568 Score = 25.0 bits (52), Expect = 2.2 Identities = 18/51 (35%), Positives = 25/51 (49%), Gaps = 5/51 (9%) Frame = +2 Query: 101 IEVDPPKAGEVR-VKITATGVCHTDAY--TLSG--KDPEGVFPVVLGHEGG 238 +E+D A E+ V + G HT Y T G DPE +P+V+ H G Sbjct: 242 LEIDRIIARELPDVDVVVGGHSHTFLYNGTADGFPDDPEDTYPIVVEHPEG 292 >AJ439398-2|CAD28125.1| 568|Anopheles gambiae putative 5' nucleotidase protein. Length = 568 Score = 25.0 bits (52), Expect = 2.2 Identities = 18/51 (35%), Positives = 25/51 (49%), Gaps = 5/51 (9%) Frame = +2 Query: 101 IEVDPPKAGEVR-VKITATGVCHTDAY--TLSG--KDPEGVFPVVLGHEGG 238 +E+D A E+ V + G HT Y T G DPE +P+V+ H G Sbjct: 242 LEIDRIIARELPDVDVVVGGHSHTFLYNGTADGFPDDPEDTYPIVVEHPEG 292 >AY578808-1|AAT07313.1| 458|Anopheles gambiae saxophone protein. Length = 458 Score = 24.6 bits (51), Expect = 2.9 Identities = 9/33 (27%), Positives = 16/33 (48%) Frame = -1 Query: 390 TLTLSRTNLLAQISFRIQAEFTCVALWDVQRYY 292 T+ L N+L + + + +C LW + YY Sbjct: 197 TVLLRHENILGYVGSDMTSRNSCTQLWLITHYY 229 >AY753540-1|AAV28543.1| 3320|Anopheles gambiae SGS3 protein. Length = 3320 Score = 24.2 bits (50), Expect = 3.9 Identities = 14/54 (25%), Positives = 25/54 (46%), Gaps = 7/54 (12%) Frame = +2 Query: 89 SIEEIE-VDPPKAGEVRVKITATGVCHTDAYTLSGKDPEGV------FPVVLGH 229 + E+I+ + + ++ K+ G HTD Y+ S K G+ P + GH Sbjct: 2253 TFEQIQGISQESSTDIWHKLVDAGYLHTDCYSTSAKKCHGLPGKSLFHPTIAGH 2306 >AY753539-1|AAV28542.1| 3318|Anopheles gambiae SGS2 protein. Length = 3318 Score = 24.2 bits (50), Expect = 3.9 Identities = 14/54 (25%), Positives = 25/54 (46%), Gaps = 7/54 (12%) Frame = +2 Query: 89 SIEEIE-VDPPKAGEVRVKITATGVCHTDAYTLSGKDPEGV------FPVVLGH 229 + E+I+ + + ++ K+ G HTD Y+ S K G+ P + GH Sbjct: 2254 TFEQIQGISQESSTDIWHKLVDAGYLHTDCYSTSAKKCHGLPGKSLFHPTIAGH 2307 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 738,744 Number of Sequences: 2352 Number of extensions: 15720 Number of successful extensions: 43 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 39 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 43 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 68995575 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -